Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62360 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62350 177 / 3e-56 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G47380 167 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25260 160 / 7e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62770 151 / 3e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62760 148 / 1e-43 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G14890 144 / 5e-43 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25250 138 / 3e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G01610 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G12390 131 / 2e-38 PME1 pectin methylesterase inhibitor 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G128300 [exp] 311 / 3e-109 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128200 [exp] 308 / 6e-108 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G113600 [exp] 194 / 3e-63 AT1G62760 171 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G119300 [exp] 180 / 1e-57 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128700 [exp] 174 / 4e-55 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127500 [exp] 173 / 6e-55 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128400 [exp] 160 / 8e-50 AT5G62360 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G113700 [exp] 156 / 3e-48 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1) Potri.012G127400 [exp] 151 / 4e-46 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031138 [exp] 203 / 2e-66 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038915 [exp] 184 / 8e-59 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031133 [exp] 179 / 3e-57 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027199 [exp] 176 / 6e-56 AT5G62360 169 / 3e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031713 [exp] 173 / 7e-55 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031717 [exp] 172 / 3e-54 AT5G62360 179 / 3e-57 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038914 [exp] 155 / 4e-48 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027198 [exp] 155 / 7e-48 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10028910 [exp] 155 / 1e-47 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031711 [exp] 151 / 3e-46 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.015G128100.1 pacid=42775160 polypeptide=Potri.015G128100.1.p locus=Potri.015G128100 ID=Potri.015G128100.1.v4.1 annot-version=v4.1 ATGGCAGCTTTATCCTCCAATTCTTTAGCTGAATTCCTTCTACTTCTTATTGCCATTAGTTCATACTTAAACTCTAGCTCAGCTGCTAGAGTCACCACAA AATCCAGCACAGAATTCATAAGAACATCTTGTAGTACAACAACTTATCCAAGACTTTGCTATACCTCCCTCTCTATCCATTCAAGCACGATCCAAACAAG CCCTAAGCTCCTAGCCAATGCAGCCCTTAACGTGACACTGTCATCAGCTAAATCAACTTCAACCATGATATCGACGCTCTCTCAAACCCATCGCATGAAG CCTAGGGAGGTGTCCGCCATGAAAGATTGTGTAGAGGAGTTGGGTGACGCGGTGAACGAGCTTGGAAAATCCATGGATGAGATGAGTCATGCTAGACAGT CCAACTTTCAGTCGATGATTGATGACGTACAAACTTGGGTTAGTGCTGCTTTGACTGATGAGAGCACGTGTAGTGATGGGTTCGCAGGAAATGCCATGAA TGGGAATTTGAAGACTGCTGTTAGGGGAAGGATTGTGAATATAGCACAGTTGACTAGCAATGCTTTGGCTTTGATCAACAATTATGCCTCAGACCCAGAA ATGTTGGGTTGA
AA sequence Show only first row Show all	>Potri.015G128100.1 pacid=42775160 polypeptide=Potri.015G128100.1.p locus=Potri.015G128100 ID=Potri.015G128100.1.v4.1 annot-version=v4.1 MAALSSNSLAEFLLLLIAISSYLNSSSAARVTTKSSTEFIRTSCSTTTYPRLCYTSLSIHSSTIQTSPKLLANAALNVTLSSAKSTSTMISTLSQTHRMK PREVSAMKDCVEELGDAVNELGKSMDEMSHARQSNFQSMIDDVQTWVSAALTDESTCSDGFAGNAMNGNLKTAVRGRIVNIAQLTSNALALINNYASDPE MLG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G62360			Plant invertase/pectin methyle...		Potri.015G128100 [exp]	0	1
AT3G50390			Transducin/WD40 repeat-like su...		Potri.006G239600 [exp]	2.00	0.9829
					Potri.018G132951 [exp]	3.87	0.9750
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Potri.011G076400 [exp]	4.00	0.9750
AT2G45260			Plant protein of unknown funct...		Potri.013G155400 [exp]	4.00	0.9711
AT1G14820			Sec14p-like phosphatidylinosit...		Potri.010G105400 [exp]	8.66	0.9698
AT4G34770			SAUR-like auxin-responsive pro...		Potri.004G165500 [exp]	10.95	0.9380
AT5G09970		CYP78A7	"cytochrome P450, family 78, s...		Potri.002G060900 [exp]	12.32	0.9654
AT1G71691			GDSL-like Lipase/Acylhydrolase...		Potri.013G102500 [exp]	13.63	0.9693
AT1G69940		ATPPME1	Pectin lyase-like superfamily ...		Potri.015G110700 [exp]	13.96	0.9548
AT4G14723		EPFL4, CLL2	epidermal patterning factor li...		Potri.008G157300 [exp]	14.42	0.9564

Compare expression of checked genes

Potri.015G128100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.