Potri.015G129000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25280 300 / 1e-103 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G26667 237 / 2e-79 PYR6 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
AT3G60180 225 / 2e-74 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT3G60961 161 / 2e-50 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G47840 102 / 7e-26 AMK2 adenosine monophosphate kinase (.1)
AT5G35170 96 / 2e-22 adenylate kinase family protein (.1.2)
AT5G63400 87 / 2e-20 ADK1 adenylate kinase 1 (.1.2)
AT5G50370 79 / 1e-17 Adenylate kinase family protein (.1)
AT2G37250 79 / 2e-17 ADK, ATPADK1 adenosine kinase (.1)
AT2G39270 74 / 3e-15 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G043300 245 / 2e-82 AT5G26667 358 / 2e-127 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.002G134600 243 / 1e-81 AT5G26667 345 / 1e-122 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.014G104700 243 / 2e-81 AT5G26667 275 / 8e-95 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.019G078200 96 / 1e-23 AT5G47840 332 / 8e-115 adenosine monophosphate kinase (.1)
Potri.013G103400 95 / 6e-23 AT5G47840 347 / 1e-120 adenosine monophosphate kinase (.1)
Potri.018G113400 92 / 2e-21 AT5G35170 838 / 0.0 adenylate kinase family protein (.1.2)
Potri.010G215300 81 / 7e-18 AT2G37250 382 / 2e-134 adenosine kinase (.1)
Potri.008G046100 79 / 3e-17 AT2G37250 377 / 1e-132 adenosine kinase (.1)
Potri.015G092800 78 / 3e-17 AT5G63400 425 / 6e-153 adenylate kinase 1 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031714 313 / 3e-102 AT4G25270 672 / 0.0 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10031135 278 / 4e-95 AT4G25280 263 / 3e-89 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10031611 236 / 9e-79 AT5G26667 343 / 1e-121 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10033733 237 / 4e-78 AT5G26667 336 / 2e-117 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10019509 150 / 6e-46 AT5G26667 217 / 5e-73 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10003504 99 / 6e-25 AT5G47840 300 / 1e-102 adenosine monophosphate kinase (.1)
Lus10009228 99 / 8e-25 AT5G47840 296 / 3e-101 adenosine monophosphate kinase (.1)
Lus10037995 97 / 1e-24 AT5G47840 315 / 9e-110 adenosine monophosphate kinase (.1)
Lus10009478 94 / 1e-23 AT5G47840 293 / 1e-101 adenosine monophosphate kinase (.1)
Lus10036326 91 / 9e-21 AT5G35170 658 / 0.0 adenylate kinase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00406 ADK Adenylate kinase
Representative CDS sequence
>Potri.015G129000.1 pacid=42775942 polypeptide=Potri.015G129000.1.p locus=Potri.015G129000 ID=Potri.015G129000.1.v4.1 annot-version=v4.1
ATGTGGCGGCGCGTGACTTCACTTTCTCCAGTGATGTCCACCTCAAAACCAACCTCGCTTGATCAGGCAGCTTCTGGCTTCAAGATATGGAGATCGTCAT
TTAGTACAGAGACACCCACTTTGGTAAAAGATGGAACTACTTCGTTCAAAGAGAGAAACCCATTTATTACTTTTGTCCTAGGTGGTCCTGGTAGTGGAAA
AGGCACACAATGCCAAAAGATTGTTGAAACATTTGGATTCAAACATCTGAGTGCAGGAGAGTTGTTAAGGAGAGAAATAGAGTCTAACAGTGAACATTGG
TCCCAGATGCTTAACACAATTAAAGAAGGCAGGATTGTTCCTTCAGAAGTGACTGTCAGACTGATCCAGCAAGAGATGGAATCAAGTGACAGCAATAAAT
TTCTCATTGATGGTTTCCCACGAACTGAGGAGAATCGAATAGCATTTGAACAATTAATTGGGCTTGAACCGAATGTTGTGCTTTTCTTTGACTGTCCTGA
AGAAGAGATGGTAAAACGAGTGCTAAACCGCAATCAGGGCCGAGTTGATGACAACATAGATACAGTCAAGAAACGTCTTAAAGTGTTTGAAATCCTAAAT
CTTCCTGTTATTGACTACTATTCCAAGAGAGGGAAACTTTGTAAGATCAATGCAGTGGGAACAGAAGATGAGATTTTTGAAAAAGTCCGCCCTATTTTTT
CTGCTTGTGCTGGAAAATGA
AA sequence
>Potri.015G129000.1 pacid=42775942 polypeptide=Potri.015G129000.1.p locus=Potri.015G129000 ID=Potri.015G129000.1.v4.1 annot-version=v4.1
MWRRVTSLSPVMSTSKPTSLDQAASGFKIWRSSFSTETPTLVKDGTTSFKERNPFITFVLGGPGSGKGTQCQKIVETFGFKHLSAGELLRREIESNSEHW
SQMLNTIKEGRIVPSEVTVRLIQQEMESSDSNKFLIDGFPRTEENRIAFEQLIGLEPNVVLFFDCPEEEMVKRVLNRNQGRVDDNIDTVKKRLKVFEILN
LPVIDYYSKRGKLCKINAVGTEDEIFEKVRPIFSACAGK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G25280 P-loop containing nucleoside t... Potri.015G129000 0 1
AT5G63520 unknown protein Potri.015G098700 2.44 0.8144
AT1G10970 ATZIP4, ZIP4 zinc transporter 4 precursor (... Potri.018G053300 7.74 0.7735
AT5G19210 P-loop containing nucleoside t... Potri.010G092200 8.48 0.8015
AT1G43850 SEU SEUSS transcriptional co-regul... Potri.002G072900 8.94 0.7996 SEU.1
AT2G47350 HIT zinc finger ;PAPA-1-like c... Potri.013G008300 9.53 0.8179
AT3G44680 HDA09, HDA9 histone deacetylase 9 (.1) Potri.001G460000 10.90 0.7805 Pt-HDA9.2,HDA904
AT1G04790 RING/U-box superfamily protein... Potri.003G176500 14.86 0.7468
AT1G74320 Protein kinase superfamily pro... Potri.001G032000 15.49 0.7353
AT5G15940 NAD(P)-binding Rossmann-fold s... Potri.001G453500 16.30 0.7362
AT4G13020 MHK Protein kinase superfamily pro... Potri.002G247500 23.32 0.7488 MHK.1

Potri.015G129000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.