Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35830 145 / 3e-41 ACO1 aconitase 1 (.1.2) AT2G05710 127 / 3e-35 ACO3 aconitase 3 (.1) AT4G26970 118 / 8e-32 ACO2 aconitase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G108100 [exp] 150 / 3e-43 AT4G35830 1668 / 0.0 aconitase 1 (.1.2) Potri.007G060900 [exp] 145 / 3e-41 AT4G35830 1658 / 0.0 aconitase 1 (.1.2) Potri.002G229200 [exp] 130 / 4e-36 AT2G05710 1674 / 0.0 aconitase 3 (.1) Potri.014G153400 [exp] 127 / 3e-35 AT2G05710 1695 / 0.0 aconitase 3 (.1) Potri.011G047600 [exp] 43 / 2e-05 AT4G21660 737 / 0.0 proline-rich spliceosome-associated (PSP) family protein (.1), proline-rich spliceosome-associated (PSP) family protein (.2) Potri.004G039000 [exp] 41 / 9e-05 AT4G21660 740 / 0.0 proline-rich spliceosome-associated (PSP) family protein (.1), proline-rich spliceosome-associated (PSP) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028405 [exp] 132 / 2e-36 AT4G35830 1695 / 0.0 aconitase 1 (.1.2) Lus10040070 [exp] 130 / 6e-36 AT2G05710 1620 / 0.0 aconitase 3 (.1) Lus10041858 [exp] 129 / 8e-36 AT4G35830 1695 / 0.0 aconitase 1 (.1.2) Lus10021533 [exp] 129 / 2e-35 AT2G05710 1523 / 0.0 aconitase 3 (.1) Lus10031561 [exp] 125 / 3e-34 AT2G05710 1674 / 0.0 aconitase 3 (.1) Lus10015116 [exp] 125 / 3e-34 AT2G05710 1707 / 0.0 aconitase 3 (.1) Lus10039678 [exp] 121 / 6e-33 AT2G05710 1704 / 0.0 aconitase 3 (.1) Lus10027165 [exp] 121 / 7e-33 AT2G05710 1706 / 0.0 aconitase 3 (.1) Lus10011207 [exp] 40 / 0.0003 AT4G21660 756 / 0.0 proline-rich spliceosome-associated (PSP) family protein (.1), proline-rich spliceosome-associated (PSP) family protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.015G130201.1 pacid=42776154 polypeptide=Potri.015G130201.1.p locus=Potri.015G130201 ID=Potri.015G130201.1.v4.1 annot-version=v4.1 ATGTGGAATCAATTATCTGTTACTTCAGGCACTCTATATGCTTGGGATTCCAAATCAACATACATACATGAGCCACCATATTTCAAAAGCATGACGATGT CTCCGCCAGGACCACATGGTGTGAATGATGCTTACTGCTCGCTCAACTTCGGGGACAGCATTAAAGCTGATCACATCTCACCAGCTGGCAGCATCCACAA GGATAGTCCTGCTACTAGATACCTCCGTCATGGAACATGGAGTGATTTGGAGGAGGAAGAAGAGGAAGAGGAAGAACATCTTGATGAAGAGGAGTTGGAG GATGATGTTCAATCTGTTGATAGCCTTTCAAGCACACCAACTGGAGTTGAGACTCCTAATGTTATTGACCCTTGCAAGTAG
AA sequence Show only first row Show all	>Potri.015G130201.1 pacid=42776154 polypeptide=Potri.015G130201.1.p locus=Potri.015G130201 ID=Potri.015G130201.1.v4.1 annot-version=v4.1 MWNQLSVTSGTLYAWDSKSTYIHEPPYFKSMTMSPPGPHGVNDAYCSLNFGDSIKADHISPAGSIHKDSPATRYLRHGTWSDLEEEEEEEEEHLDEEELE DDVQSVDSLSSTPTGVETPNVIDPCK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G35830		ACO1	aconitase 1 (.1.2)		Potri.015G130201 [exp]	0	1
AT4G08460			Protein of unknown function (D...		Potri.005G172300 [exp]	2.44	0.9037
AT1G80860		ATPLMT	ARABIDOPSIS PHOSPHOLIPID N-MET...		Potri.003G182400 [exp]	3.16	0.8701
AT4G26270		PFK3	phosphofructokinase 3 (.1)		Potri.006G152600 [exp]	3.74	0.8559
AT4G30993			Calcineurin-like metallo-phosp...		Potri.018G110300 [exp]	4.24	0.8575
AT3G03550			RING/U-box superfamily protein...		Potri.019G043900 [exp]	4.47	0.8727
AT1G67410			Exostosin family protein (.1)		Potri.010G227901 [exp]	9.38	0.8400
AT5G65950			unknown protein		Potri.001G457201 [exp]	11.40	0.7805
AT5G24810			ABC1 family protein (.1.2)		Potri.012G082950 [exp]	11.83	0.8292
					Potri.007G134101 [exp]	15.62	0.7823
AT5G51280			DEAD-box protein abstrakt, put...		Potri.005G047301 [exp]	17.32	0.8332

Compare expression of checked genes

Potri.015G130201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.