Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G22820 115 / 2e-33 A20/AN1-like zinc finger family protein (.1.2) AT1G12440 108 / 4e-31 A20/AN1-like zinc finger family protein (.1.2) AT4G12040 108 / 7e-31 AtSAP7 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2) AT4G14225 103 / 1e-29 A20/AN1-like zinc finger family protein (.1) AT2G36320 102 / 2e-28 A20/AN1-like zinc finger family protein (.1) AT4G25380 97 / 1e-26 AtSAP10, SAP10 Arabidopsis thaliana stress-associated protein 10, stress-associated protein 10 (.1) AT2G27580 92 / 2e-24 A20/AN1-like zinc finger family protein (.1.2) AT3G52800 86 / 4e-22 A20/AN1-like zinc finger family protein (.1) AT1G51200 85 / 1e-21 A20/AN1-like zinc finger family protein (.1.2.3.4) AT3G12630 79 / 2e-19 SAP5 stress associated protein 5, A20/AN1-like zinc finger family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G131900 [exp] 194 / 5e-65 AT4G22820 123 / 2e-36 A20/AN1-like zinc finger family protein (.1.2) Potri.012G130100 [exp] 165 / 1e-53 AT4G22820 114 / 7e-33 A20/AN1-like zinc finger family protein (.1.2) Potri.012G130000 [exp] 163 / 1e-52 AT4G22820 121 / 1e-35 A20/AN1-like zinc finger family protein (.1.2) Potri.001G115000 [exp] 107 / 3e-30 AT4G12040 169 / 4e-54 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2) Potri.007G078500 [exp] 102 / 2e-28 AT4G12040 120 / 6e-35 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2) Potri.009G144100 [exp] 99 / 2e-27 AT2G27580 166 / 5e-53 A20/AN1-like zinc finger family protein (.1.2) Potri.003G117100 [exp] 97 / 2e-26 AT1G12440 170 / 2e-54 A20/AN1-like zinc finger family protein (.1.2) Potri.003G205500 [exp] 92 / 2e-24 AT1G51200 202 / 4e-67 A20/AN1-like zinc finger family protein (.1.2.3.4) Potri.004G184300 [exp] 92 / 2e-24 AT2G27580 156 / 4e-49 A20/AN1-like zinc finger family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030150 [exp] 119 / 2e-35 AT4G12040 119 / 8e-35 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2) Lus10003246 [exp] 107 / 2e-30 AT2G36320 201 / 3e-67 A20/AN1-like zinc finger family protein (.1) Lus10007015 [exp] 105 / 6e-30 AT1G12440 207 / 3e-69 A20/AN1-like zinc finger family protein (.1.2) Lus10006671 [exp] 104 / 3e-29 AT1G12440 204 / 3e-68 A20/AN1-like zinc finger family protein (.1.2) Lus10028903 [exp] 99 / 6e-27 AT1G12440 205 / 3e-68 A20/AN1-like zinc finger family protein (.1.2) Lus10035603 [exp] 91 / 2e-24 AT2G36320 152 / 3e-48 A20/AN1-like zinc finger family protein (.1) Lus10031833 [exp] 91 / 7e-24 AT1G51200 186 / 5e-61 A20/AN1-like zinc finger family protein (.1.2.3.4) Lus10031262 [exp] 87 / 3e-22 AT1G51200 187 / 2e-61 A20/AN1-like zinc finger family protein (.1.2.3.4) Lus10008912 [exp] 81 / 8e-20 AT1G12440 202 / 4e-67 A20/AN1-like zinc finger family protein (.1.2) Lus10020594 [exp] 79 / 3e-19 AT2G36320 149 / 2e-46 A20/AN1-like zinc finger family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01428 [poplar] [flax] zf-AN1 AN1-like Zinc finger PF01754 [poplar] [flax] zf-A20 A20-like zinc finger
Representative CDS sequence Show only first row Show all	>Potri.015G131500.2 pacid=42775768 polypeptide=Potri.015G131500.2.p locus=Potri.015G131500 ID=Potri.015G131500.2.v4.1 annot-version=v4.1 ATGGATTCACAAGACAATTTGACTCGTACGCTGTGCGCCAAGGGCTGTGGCTTCTTTGGGTCTCCAGAGAACAAAAATCTATGTTCAAAGTGTTACAAAG ATTATCTCAAAGAAGAGAACCAAGCTGTTGTTTCAGATGAAACAGCTTCAACAGCCTCTACTACTGCATCCACTTCAACTGTGCTGAAAAATAGATGTGA ATGCTGCAACAAGAAAGTTGGTTTGATGGGGTTCAAGTGCCGCTGCGGGAAAACTTTCTGTGGGGTTCATCGATATGCCAAGGTGCACTCTTGCACCTTT GATTTCAAGACTTACGATCGACAAAATTTGGCTAAGCAAAACCCACTCGTAGCAGGCGATAAGCTTCATACTAGAATCTGA
AA sequence Show only first row Show all	>Potri.015G131500.2 pacid=42775768 polypeptide=Potri.015G131500.2.p locus=Potri.015G131500 ID=Potri.015G131500.2.v4.1 annot-version=v4.1 MDSQDNLTRTLCAKGCGFFGSPENKNLCSKCYKDYLKEENQAVVSDETASTASTTASTSTVLKNRCECCNKKVGLMGFKCRCGKTFCGVHRYAKVHSCTF DFKTYDRQNLAKQNPLVAGDKLHTRI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G22820			A20/AN1-like zinc finger famil...		Potri.015G131500 [exp]	0	1
					Potri.005G206901 [exp]	9.59	0.8468
					Potri.005G246900 [exp]	10.48	0.8069
					Potri.005G096200 [exp]	11.13	0.8161
AT1G12520		ATCCS, CCS1	copper chaperone for SOD1 (.1....		Potri.001G113800 [exp]	14.66	0.8147
AT4G39250	MYB	RSM2, ATRL1	RADIALIS-LIKE SANT/MYB 2, RAD-...		Potri.009G116600 [exp]	19.51	0.8168
AT5G56320		ATHEXPALPHA1.5,...	EXPANSIN 14, expansin A14 (.1)		Potri.003G223501 [exp]	20.00	0.8079
					Potri.004G063101 [exp]	21.21	0.8079
					Potri.010G212850 [exp]	27.65	0.8013
AT2G32235			unknown protein		Potri.004G028100 [exp]	27.74	0.8017
					Potri.005G073733 [exp]	30.98	0.8078

Compare expression of checked genes

Potri.015G131500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.