Potri.015G131900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G22820 123 / 2e-36 A20/AN1-like zinc finger family protein (.1.2)
AT1G12440 119 / 5e-35 A20/AN1-like zinc finger family protein (.1.2)
AT4G12040 115 / 2e-33 AtSAP7 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
AT4G14225 107 / 1e-30 A20/AN1-like zinc finger family protein (.1)
AT2G36320 106 / 8e-30 A20/AN1-like zinc finger family protein (.1)
AT2G27580 100 / 2e-27 A20/AN1-like zinc finger family protein (.1.2)
AT4G25380 97 / 9e-27 AtSAP10, SAP10 Arabidopsis thaliana stress-associated protein 10, stress-associated protein 10 (.1)
AT1G51200 92 / 4e-24 A20/AN1-like zinc finger family protein (.1.2.3.4)
AT3G52800 90 / 3e-23 A20/AN1-like zinc finger family protein (.1)
AT3G12630 83 / 1e-20 SAP5 stress associated protein 5, A20/AN1-like zinc finger family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G131500 194 / 6e-65 AT4G22820 114 / 3e-33 A20/AN1-like zinc finger family protein (.1.2)
Potri.012G130100 194 / 8e-65 AT4G22820 114 / 7e-33 A20/AN1-like zinc finger family protein (.1.2)
Potri.012G130000 193 / 3e-64 AT4G22820 121 / 1e-35 A20/AN1-like zinc finger family protein (.1.2)
Potri.001G115000 117 / 7e-34 AT4G12040 169 / 4e-54 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
Potri.007G078500 111 / 6e-32 AT4G12040 120 / 6e-35 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
Potri.003G205500 108 / 2e-30 AT1G51200 202 / 4e-67 A20/AN1-like zinc finger family protein (.1.2.3.4)
Potri.009G144100 107 / 3e-30 AT2G27580 166 / 5e-53 A20/AN1-like zinc finger family protein (.1.2)
Potri.003G117100 106 / 1e-29 AT1G12440 170 / 2e-54 A20/AN1-like zinc finger family protein (.1.2)
Potri.006G056500 105 / 3e-29 AT1G51200 167 / 2e-53 A20/AN1-like zinc finger family protein (.1.2.3.4)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030150 132 / 4e-40 AT4G12040 119 / 8e-35 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
Lus10007015 117 / 7e-34 AT1G12440 207 / 3e-69 A20/AN1-like zinc finger family protein (.1.2)
Lus10006671 115 / 3e-33 AT1G12440 204 / 3e-68 A20/AN1-like zinc finger family protein (.1.2)
Lus10003246 111 / 9e-32 AT2G36320 201 / 3e-67 A20/AN1-like zinc finger family protein (.1)
Lus10028903 109 / 7e-31 AT1G12440 205 / 3e-68 A20/AN1-like zinc finger family protein (.1.2)
Lus10008912 105 / 2e-29 AT1G12440 202 / 4e-67 A20/AN1-like zinc finger family protein (.1.2)
Lus10031262 104 / 8e-29 AT1G51200 187 / 2e-61 A20/AN1-like zinc finger family protein (.1.2.3.4)
Lus10031833 102 / 5e-28 AT1G51200 186 / 5e-61 A20/AN1-like zinc finger family protein (.1.2.3.4)
Lus10035603 92 / 2e-24 AT2G36320 152 / 3e-48 A20/AN1-like zinc finger family protein (.1)
Lus10038901 83 / 5e-20 AT4G25380 80 / 9e-19 Arabidopsis thaliana stress-associated protein 10, stress-associated protein 10 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01428 zf-AN1 AN1-like Zinc finger
PF01754 zf-A20 A20-like zinc finger
Representative CDS sequence
>Potri.015G131900.1 pacid=42774935 polypeptide=Potri.015G131900.1.p locus=Potri.015G131900 ID=Potri.015G131900.1.v4.1 annot-version=v4.1
ATGGATTCACAAGACAAGTTGACTCCTGCGTTGTGTGCCAAGGGCTGTGGCTTCTTTGGCTCTCCAGAGAACAAAAATCTTTGTTCAAAGTGTTACAAAG
ACTATCTCAAAGAAGAGGTAATTGCTAAGACTGCAGACAAACTCTCTGAACTTGTCATCACCCCATCATCTGATGATAAGAACCCAGCTGTTGTTTCTAA
TGAAACAGCTTCAACAACCACTGCTACTGCATCCGCTACAACAGTGCTGAAAAATAGATGTGAATGCTGCGGCAAGAAAGTTGGTTTGATGGGGTTCAAG
TGCCGCTGTGGGAAAACCTTCTGTGGGGTTCATCGATATGCCAAGGAGCACTCCTGCACCTTTGATTTCAAGACTTTTGATCGACAAATTTTGGCTAAGC
AAAACCCGCTTGTTGCTGGTGATAAACTTGATGCTAGAATCTGA
AA sequence
>Potri.015G131900.1 pacid=42774935 polypeptide=Potri.015G131900.1.p locus=Potri.015G131900 ID=Potri.015G131900.1.v4.1 annot-version=v4.1
MDSQDKLTPALCAKGCGFFGSPENKNLCSKCYKDYLKEEVIAKTADKLSELVITPSSDDKNPAVVSNETASTTTATASATTVLKNRCECCGKKVGLMGFK
CRCGKTFCGVHRYAKEHSCTFDFKTFDRQILAKQNPLVAGDKLDARI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G22820 A20/AN1-like zinc finger famil... Potri.015G131900 0 1
AT1G01900 SBTI1.1, ATSBT1... subtilase family protein (.1) Potri.002G152025 36.66 0.4438

Potri.015G131900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.