Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G26810 180 / 2e-60 SWIB/MDM2 domain superfamily protein (.1.2) AT2G35605 73 / 4e-18 SWIB/MDM2 domain superfamily protein (.1) AT1G31760 67 / 7e-16 SWIB/MDM2 domain superfamily protein (.1) AT4G34290 67 / 1e-15 SWIB/MDM2 domain superfamily protein (.1) AT2G14880 64 / 3e-14 SWIB/MDM2 domain superfamily protein (.1) AT3G03590 59 / 3e-12 SWIB/MDM2 domain superfamily protein (.1) AT4G22360 54 / 1e-09 SWIB complex BAF60b domain-containing protein (.1) AT1G49520 50 / 2e-08 SWIB complex BAF60b domain-containing protein (.1) AT3G19080 48 / 1e-07 SWIB complex BAF60b domain-containing protein (.1) AT3G48600 47 / 2e-07 SWIB complex BAF60b domain-containing protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G092200 [exp] 70 / 2e-16 AT2G14880 169 / 7e-55 SWIB/MDM2 domain superfamily protein (.1) Potri.001G297400 [exp] 68 / 7e-16 AT2G14880 142 / 3e-44 SWIB/MDM2 domain superfamily protein (.1) Potri.013G070600 [exp] 59 / 2e-12 AT2G35605 108 / 2e-31 SWIB/MDM2 domain superfamily protein (.1) Potri.009G106700 [exp] 53 / 2e-09 AT1G49520 301 / 5e-100 SWIB complex BAF60b domain-containing protein (.1) Potri.005G134500 [exp] 50 / 3e-08 AT3G19080 226 / 3e-70 SWIB complex BAF60b domain-containing protein (.1) Potri.004G145200 [exp] 50 / 3e-08 AT1G49520 308 / 6e-103 SWIB complex BAF60b domain-containing protein (.1) Potri.016G013400 [exp] 47 / 5e-07 AT4G22360 301 / 1e-99 SWIB complex BAF60b domain-containing protein (.1) Potri.006G010700 [exp] 46 / 5e-07 AT4G22360 303 / 2e-100 SWIB complex BAF60b domain-containing protein (.1) Potri.005G078400 [exp] 45 / 5e-07 AT2G35605 66 / 6e-15 SWIB/MDM2 domain superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038799 [exp] 170 / 8e-55 AT4G26810 160 / 1e-50 SWIB/MDM2 domain superfamily protein (.1.2) Lus10002106 [exp] 70 / 2e-17 AT4G34290 109 / 2e-32 SWIB/MDM2 domain superfamily protein (.1) Lus10013893 [exp] 72 / 4e-17 AT2G14880 143 / 7e-45 SWIB/MDM2 domain superfamily protein (.1) Lus10005667 [exp] 64 / 2e-14 AT3G03590 118 / 4e-35 SWIB/MDM2 domain superfamily protein (.1) Lus10009333 [exp] 52 / 5e-09 AT3G19080 266 / 4e-87 SWIB complex BAF60b domain-containing protein (.1) Lus10019640 [exp] 48 / 1e-07 AT3G19080 256 / 2e-81 SWIB complex BAF60b domain-containing protein (.1) Lus10014892 [exp] 42 / 2e-05 AT4G22360 243 / 2e-76 SWIB complex BAF60b domain-containing protein (.1) Lus10016581 [exp] 42 / 3e-05 AT4G22360 190 / 1e-55 SWIB complex BAF60b domain-containing protein (.1) Lus10018078 [exp] 38 / 0.0006 AT2G16485 986 / 0.0 nucleic acid binding;zinc ion binding;DNA binding (.1) Lus10042072 [exp] 38 / 0.0007 AT2G16485 1007 / 0.0 nucleic acid binding;zinc ion binding;DNA binding (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02201 [poplar] [flax] SWIB SWIB/MDM2 domain
Representative CDS sequence Show only first row Show all	>Potri.015G137600.6 pacid=42776565 polypeptide=Potri.015G137600.6.p locus=Potri.015G137600 ID=Potri.015G137600.6.v4.1 annot-version=v4.1 ATGCTGCCGCAGAAGATGAAGAAGGCCATCACAGATAACCCAAAGCAGCTTGCCAACTTAATTGATCTTGTAAATTTACCTTCTACACTTAGAGATTTTG TGGGTCAGTCTCAGATTTCTCATTTGGGCTGTTTCATGCGTGTCTGGTCCTATATCAAAACCAACAACCTCCAGGATCCAAACAACAAGAATGTGGTCAA TTGTGATGAAAAGTTGAAAAGTATCTTGCTGGGCAAACAACAGGTTGAATTGGTCGAACTTCCTGCGCTGATCAAATTGCATTTTCCCAAACAGAAAAAA TTTCCCTGA
AA sequence Show only first row Show all	>Potri.015G137600.6 pacid=42776565 polypeptide=Potri.015G137600.6.p locus=Potri.015G137600 ID=Potri.015G137600.6.v4.1 annot-version=v4.1 MLPQKMKKAITDNPKQLANLIDLVNLPSTLRDFVGQSQISHLGCFMRVWSYIKTNNLQDPNNKNVVNCDEKLKSILLGKQQVELVELPALIKLHFPKQKK FP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G26810			SWIB/MDM2 domain superfamily p...		Potri.015G137600 [exp]	0	1
AT3G52390			TatD related DNase (.1.2)		Potri.016G068400 [exp]	3.46	0.7995
AT3G58830			haloacid dehalogenase (HAD) su...		Potri.005G201100 [exp]	3.87	0.7994
AT4G22930		PYR4, DHOASE	DIHYDROOROTASE, pyrimidin 4 (....		Potri.007G139700 [exp]	6.32	0.8121
AT1G01290		CNX3	cofactor of nitrate reductase ...		Potri.014G099500 [exp]	13.03	0.7422
AT5G54180		PTAC15	plastid transcriptionally acti...		Potri.015G005200 [exp]	22.64	0.7999
AT1G15220		ATCCMH	cytochrome c biogenesis protei...		Potri.003G052000 [exp]	26.45	0.7492
AT2G37020			Translin family protein (.1.2)		Potri.006G126200 [exp]	33.91	0.7312
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Potri.010G084800 [exp]	37.09	0.7432	PBD2.2
AT4G26055			unknown protein		Potri.010G204200 [exp]	47.01	0.7704
AT2G27490		ATCOAE	dephospho-CoA kinase family (....		Potri.010G206900 [exp]	51.38	0.7423

Compare expression of checked genes

Potri.015G137600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.