Potri.015G138300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G51890 330 / 6e-114 Peroxidase superfamily protein (.1)
AT5G42180 225 / 9e-73 PER64 peroxidase 64, Peroxidase superfamily protein (.1)
AT1G05260 180 / 7e-55 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
AT4G11290 177 / 7e-54 Peroxidase superfamily protein (.1)
AT5G15180 176 / 1e-53 Peroxidase superfamily protein (.1)
AT3G01190 175 / 3e-53 Peroxidase superfamily protein (.1)
AT3G21770 175 / 5e-53 Peroxidase superfamily protein (.1)
AT1G05250 171 / 3e-51 Peroxidase superfamily protein (.1)
AT1G05240 171 / 3e-51 Peroxidase superfamily protein (.1)
AT5G14130 164 / 7e-49 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G108900 242 / 3e-79 AT5G42180 442 / 2e-157 peroxidase 64, Peroxidase superfamily protein (.1)
Potri.002G018000 236 / 1e-76 AT5G42180 483 / 1e-173 peroxidase 64, Peroxidase superfamily protein (.1)
Potri.007G122451 189 / 2e-58 AT5G15180 374 / 3e-130 Peroxidase superfamily protein (.1)
Potri.007G122200 189 / 3e-58 AT5G15180 395 / 2e-138 Peroxidase superfamily protein (.1)
Potri.007G122301 187 / 2e-57 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122250 187 / 2e-57 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122401 187 / 2e-57 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122351 187 / 2e-57 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.015G003500 179 / 9e-55 AT1G05260 291 / 1e-97 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031664 332 / 1e-114 AT5G51890 453 / 1e-161 Peroxidase superfamily protein (.1)
Lus10027405 329 / 3e-113 AT5G51890 448 / 2e-159 Peroxidase superfamily protein (.1)
Lus10034547 221 / 6e-71 AT5G42180 471 / 7e-169 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10005614 214 / 2e-68 AT5G42180 461 / 6e-165 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10017288 214 / 4e-68 AT5G42180 462 / 4e-165 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10028736 172 / 4e-52 AT1G05260 266 / 4e-88 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10039445 170 / 5e-51 AT5G40150 467 / 8e-167 Peroxidase superfamily protein (.1)
Lus10027163 169 / 1e-50 AT4G11290 491 / 4e-176 Peroxidase superfamily protein (.1)
Lus10018374 168 / 3e-50 AT3G01190 414 / 4e-146 Peroxidase superfamily protein (.1)
Lus10039681 167 / 5e-50 AT4G11290 488 / 3e-175 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.015G138300.1 pacid=42775752 polypeptide=Potri.015G138300.1.p locus=Potri.015G138300 ID=Potri.015G138300.1.v4.1 annot-version=v4.1
ATGGCTGTTTTTGCATCAAACTTAATGTCTTTAGCGATTAGCTTTCTCCTCCTAATCTTGATTTCGCCTTCGAAAGCTGTGCTTAATAATGCTCATTATT
ATGATCAAACATGTCCACAAGCAGAGAAGATAATTTTTGAGACAGTTCGTAATGCTTCCATGCATGATCCTAAAGTCCCAGCTCGTATACTTGGGATGTT
CTTTCATGACTGCTTCATAAGGGCATCTAAGCTTGAAATGGCTTGTCCACACACGGTTTCATGTGCTGATATCATAGCCATAGCAGCAAGAGATGTCGTG
ACCATGTCTGGAAAACCTTCTTGGAATGTGCTGACAGGAAGGAAAGATGGAAGAGTGTCTAAAGCTAATGATACAATTACCTTACCAGCTCCAACCTTCA
ATGCTATGCAATTAATTCAAAGCTTTGCTAAGAGAGGTCTAGGAGTTAAAGACTTGGTAGCTTTGTCAGGTGGCCACAATTTAGGGTTCTCACATTGCTC
TTCTTTCGAAGCTCGACTTCAAAACTTTAGTTCAGTTCATGACATTGATCCAAGCATGAATACTCGGTTTGCTGGGAATCTTAAAAGGAAATGCCCTAAA
CCAAACAAGGATCACAGTGCAGGAGAATTCTTGGACTCAACCTCATCAACATTCGATAATGACTATTACAAGAGAGATATCGAAGGAAAAGGTATCTTTG
GTTCATATCATGCACTGCTTGGTGATTACAGAGAATTTGCAGCTTCAATGATAAAACTTGGAAAAGTCGGGGTAATAAAAAATGGAGAAGTGAGGTTTAA
GTGCCGAGTGGTTAATTAA
AA sequence
>Potri.015G138300.1 pacid=42775752 polypeptide=Potri.015G138300.1.p locus=Potri.015G138300 ID=Potri.015G138300.1.v4.1 annot-version=v4.1
MAVFASNLMSLAISFLLLILISPSKAVLNNAHYYDQTCPQAEKIIFETVRNASMHDPKVPARILGMFFHDCFIRASKLEMACPHTVSCADIIAIAARDVV
TMSGKPSWNVLTGRKDGRVSKANDTITLPAPTFNAMQLIQSFAKRGLGVKDLVALSGGHNLGFSHCSSFEARLQNFSSVHDIDPSMNTRFAGNLKRKCPK
PNKDHSAGEFLDSTSSTFDNDYYKRDIEGKGIFGSYHALLGDYREFAASMIKLGKVGVIKNGEVRFKCRVVN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G51890 Peroxidase superfamily protein... Potri.015G138300 0 1
AT1G53720 ATCYP59, CYP59 cyclophilin 59 (.1) Potri.007G067000 1.41 0.9505
AT3G22680 RDM1 RNA-DIRECTED DNA METHYLATION 1... Potri.008G076500 2.44 0.9373
Potri.001G338300 6.63 0.9274
Potri.002G133566 7.34 0.8959
Potri.010G199150 14.49 0.9218
AT4G15910 ATDI21 drought-induced 21 (.1) Potri.010G012100 15.29 0.8613
AT2G23770 protein kinase family protein ... Potri.005G128200 15.65 0.8547
AT2G45130 ATSPX3 ARABIDOPSIS THALIANA SPX DOMAI... Potri.001G135950 15.81 0.8982
AT3G17380 TRAF-like family protein (.1) Potri.008G199400 17.43 0.9185
Potri.013G066750 18.46 0.9164

Potri.015G138300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.