Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G52140 72 / 6e-16 RING/U-box superfamily protein (.1) AT5G07225 70 / 3e-15 RING/U-box superfamily protein (.1) AT3G63530 66 / 2e-13 BB2, BB BIG BROTHER, RING/U-box superfamily protein (.1.2) AT3G19910 61 / 2e-11 RING/U-box superfamily protein (.1) AT2G40830 58 / 1e-10 RHC1A RING-H2 finger C1A (.1.2.3) AT3G47180 57 / 2e-10 RING/U-box superfamily protein (.1) AT5G52150 54 / 1e-09 RING/U-box superfamily protein (.1) AT5G20910 55 / 2e-09 AIP2 ABI3-interacting protein 2, RING/U-box superfamily protein (.1) AT2G03000 55 / 2e-09 RING/U-box superfamily protein (.1) AT2G15530 55 / 2e-09 RING/U-box superfamily protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G136400 [exp] 152 / 2e-47 AT5G52140 113 / 1e-30 RING/U-box superfamily protein (.1) Potri.003G204500 [exp] 74 / 1e-16 AT3G63530 175 / 2e-54 BIG BROTHER, RING/U-box superfamily protein (.1.2) Potri.001G019600 [exp] 73 / 2e-16 AT3G63530 176 / 1e-54 BIG BROTHER, RING/U-box superfamily protein (.1.2) Potri.001G267700 [exp] 67 / 3e-14 AT3G63530 301 / 4e-104 BIG BROTHER, RING/U-box superfamily protein (.1.2) Potri.009G062100 [exp] 65 / 3e-13 AT3G63530 269 / 4e-91 BIG BROTHER, RING/U-box superfamily protein (.1.2) Potri.005G090800 [exp] 62 / 3e-12 AT3G19910 187 / 5e-57 RING/U-box superfamily protein (.1) Potri.005G180300 [exp] 59 / 2e-11 AT3G47180 117 / 1e-32 RING/U-box superfamily protein (.1) Potri.005G090500 [exp] 59 / 6e-11 AT3G19950 279 / 4e-93 RING/U-box superfamily protein (.1) Potri.007G073200 [exp] 59 / 6e-11 AT3G19910 303 / 3e-102 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031275 [exp] 69 / 8e-15 AT3G63530 174 / 4e-54 BIG BROTHER, RING/U-box superfamily protein (.1.2) Lus10005768 [exp] 69 / 1e-14 AT5G52140 90 / 7e-21 RING/U-box superfamily protein (.1) Lus10019703 [exp] 64 / 7e-13 AT3G63530 285 / 1e-97 BIG BROTHER, RING/U-box superfamily protein (.1.2) Lus10016416 [exp] 64 / 8e-13 AT3G63530 287 / 2e-98 BIG BROTHER, RING/U-box superfamily protein (.1.2) Lus10031842 [exp] 63 / 2e-12 AT3G63530 160 / 1e-48 BIG BROTHER, RING/U-box superfamily protein (.1.2) Lus10002554 [exp] 60 / 7e-12 AT3G63530 122 / 1e-34 BIG BROTHER, RING/U-box superfamily protein (.1.2) Lus10013235 [exp] 60 / 3e-11 AT2G40830 334 / 7e-115 RING-H2 finger C1A (.1.2.3) Lus10030755 [exp] 60 / 3e-11 AT2G40830 336 / 2e-115 RING-H2 finger C1A (.1.2.3) Lus10010179 [exp] 59 / 7e-11 AT3G19950 285 / 6e-96 RING/U-box superfamily protein (.1) Lus10017383 [exp] 56 / 1e-10 AT3G19950 127 / 8e-37 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.015G138700.2 pacid=42775120 polypeptide=Potri.015G138700.2.p locus=Potri.015G138700 ID=Potri.015G138700.2.v4.1 annot-version=v4.1 ATGACTAGGAAACTACAGAATATGTCCATATATGGCGGACACTCGGGAAGAGCAACTAATCCTGCATGGGAGGATAATCGTGGAGGAACTGCGCGGGTGT CTAATGTTCAAACACAGGCTGGACCTGTAGTTGATCTAGATAATATGTCATATGAGGAAACGAATCGATTCCAAGAATCCTTGGGCAGTGTGAGCCAAGG TGTGTCACAGCAAGCAGTCTCTAGGTTGCCTATTCACAAGTACAGTCCATCAAGCAGCAAAGGCAAATCAGGAGGAGATACAGAGTGTGTCATCTGCAAA ATGGAGTACGAGAGGGGGGATCGCTTGATCACATTGCCCTGTGCACACCAATATCACGAGGATTGCATTAAAAAATGGCTTGAAGATCACAAGGATTGCT GTGTCTGCAAGGAGGAGGTGTCTGTTTGA
AA sequence Show only first row Show all	>Potri.015G138700.2 pacid=42775120 polypeptide=Potri.015G138700.2.p locus=Potri.015G138700 ID=Potri.015G138700.2.v4.1 annot-version=v4.1 MTRKLQNMSIYGGHSGRATNPAWEDNRGGTARVSNVQTQAGPVVDLDNMSYEETNRFQESLGSVSQGVSQQAVSRLPIHKYSPSSSKGKSGGDTECVICK MEYERGDRLITLPCAHQYHEDCIKKWLEDHKDCCVCKEEVSV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G52140			RING/U-box superfamily protein...		Potri.015G138700 [exp]	0	1
AT5G35910			Polynucleotidyl transferase, r...		Potri.013G062800 [exp]	4.12	0.8286
AT1G31840			Tetratricopeptide repeat (TPR)...		Potri.015G036400 [exp]	5.19	0.8196
AT4G14385			unknown protein		Potri.002G038700 [exp]	11.31	0.8019
AT5G05550	Trihelix		sequence-specific DNA binding ...		Potri.008G071300 [exp]	11.53	0.8103
AT5G64160			unknown protein		Potri.001G206032 [exp]	13.26	0.8138
AT2G21470		EMB2764, ATSAE2...	EMBRYO DEFECTIVE 2764, SUMO-ac...		Potri.009G120200 [exp]	14.07	0.7825
AT3G10250			Plant protein 1589 of unknown ...		Potri.016G038100 [exp]	15.09	0.7962
AT5G05800			unknown protein		Potri.015G137800 [exp]	15.19	0.8002
AT3G19180		ATCDP1, ARC6H, ...	A. THALIANA CHLOROPLAST DIVISI...		Potri.012G036100 [exp]	17.23	0.7548
AT1G10600		AMSH2	associated molecule with the S...		Potri.010G041200 [exp]	18.43	0.7776

Compare expression of checked genes

Potri.015G138700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.