Potri.015G139966 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G138200 118 / 2e-36 ND /
Potri.015G139900 43 / 7e-07 AT1G63245 44 / 3e-07 CLAVATA3/ESR-RELATED 14 (.1)
Potri.012G138100 37 / 0.0002 AT1G63245 41 / 4e-06 CLAVATA3/ESR-RELATED 14 (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.015G139966.1 pacid=42774915 polypeptide=Potri.015G139966.1.p locus=Potri.015G139966 ID=Potri.015G139966.1.v4.1 annot-version=v4.1
ATGAGGAATAAAAATCCTCAGCTGTTCCTTATTTTCCTGATAGTGTTCCTGGTACTCGTTCATGGCACCACTTGCCGCGATACCAAAAGATCTACTAGCA
ATGGAGAAACAGAACAAGGGTCGAAAACCAAACATTCTTCAATGTTTCTACAAGCCCTTTCTTCCATTTTTAAGGCTTCAGAATCCAGCACGAACAACAT
CAAGGCACTTCACACCGTCTCGCGCAGGCTTGTTCCTTGTGGACCAAATCCACTCCACAACTGA
AA sequence
>Potri.015G139966.1 pacid=42774915 polypeptide=Potri.015G139966.1.p locus=Potri.015G139966 ID=Potri.015G139966.1.v4.1 annot-version=v4.1
MRNKNPQLFLIFLIVFLVLVHGTTCRDTKRSTSNGETEQGSKTKHSSMFLQALSSIFKASESSTNNIKALHTVSRRLVPCGPNPLHN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.015G139966 0 1
Potri.003G103100 1.73 0.9193
AT1G14590 Nucleotide-diphospho-sugar tra... Potri.012G037300 5.47 0.7912
AT2G45400 BEN1 NAD(P)-binding Rossmann-fold s... Potri.002G147701 14.14 0.7761
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Potri.014G037500 14.35 0.7540
AT2G02850 ARPN plantacyanin (.1) Potri.002G241500 14.83 0.8363
Potri.012G138200 15.49 0.8212
AT2G45400 BEN1 NAD(P)-binding Rossmann-fold s... Potri.002G147601 18.49 0.7685
AT2G45400 BEN1 NAD(P)-binding Rossmann-fold s... Potri.002G147400 20.04 0.7661 Pt-DFR1.4
AT4G34640 ERG9, SQS1 squalene synthase 1 (.1) Potri.009G123100 23.66 0.7654 SQS1.2
AT3G02875 ILR1 IAA-LEUCINE RESISTANT 1, Pepti... Potri.016G074100 31.46 0.7181

Potri.015G139966 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.