Potri.015G142100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62065 63 / 3e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G139700 123 / 5e-38 AT5G62065 101 / 6e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014998 81 / 2e-20 AT5G62065 125 / 1e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10001703 37 / 0.0004 AT4G33355 86 / 9e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.015G142100.2 pacid=42775131 polypeptide=Potri.015G142100.2.p locus=Potri.015G142100 ID=Potri.015G142100.2.v4.1 annot-version=v4.1
ATGGAGGTCCAAAAAATAATGACAGGAGTGCTATTGTTGCTGTTGCTATCATGGGCCGTGGCAGTGGCGGCCGATGTCGATTGCACCACCCTGGCAGGGT
TCCTCACGGCTTGCTCCACGTTCATCACCTATGGTACACCAGACCCACTTCCAGGTTCACCATGTTGTGATTCCATGATGAGCTTGAATGTGATTGCTGA
ATCTGGGAATAACAGGAGGTCTATATGTCAATGCTTAATGGGCCTCATCAAACACCTATAA
AA sequence
>Potri.015G142100.2 pacid=42775131 polypeptide=Potri.015G142100.2.p locus=Potri.015G142100 ID=Potri.015G142100.2.v4.1 annot-version=v4.1
MEVQKIMTGVLLLLLLSWAVAVAADVDCTTLAGFLTACSTFITYGTPDPLPGSPCCDSMMSLNVIAESGNNRRSICQCLMGLIKHL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G62065 Bifunctional inhibitor/lipid-t... Potri.015G142100 0 1
AT4G32810 MAX4, CCD8, ATC... MORE AXILLARY BRANCHING 4, car... Potri.018G044100 2.00 0.9036
Potri.019G005913 3.46 0.8920
AT4G29035 Plant self-incompatibility pro... Potri.016G066900 4.69 0.7791
AT1G02630 Nucleoside transporter family ... Potri.018G130000 5.19 0.8510
AT5G66815 unknown protein Potri.014G034500 7.48 0.8639
Potri.019G133300 7.93 0.7832
Potri.003G056450 8.36 0.8608
AT3G14720 ATMPK19 ARABIDOPSIS THALIANA MAP KINAS... Potri.011G102500 8.94 0.8456 Pt-TDY1.1
AT4G24120 ATYSL1, YSL1 YELLOW STRIPE like 1 (.1) Potri.001G082400 11.83 0.8182
AT2G13620 ATCHX15 CATION/H+ EXCHANGER 15, cation... Potri.019G123700 12.24 0.7657

Potri.015G142100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.