Potri.015G143150 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.015G143150.1 pacid=42775570 polypeptide=Potri.015G143150.1.p locus=Potri.015G143150 ID=Potri.015G143150.1.v4.1 annot-version=v4.1
ATGGTGCATGGTCCAGATCCATTTTGTGGAATTGATGGCGAAAAACAGGTTGCTGGTTTGCCCAGCGATGCCTATAAAAGGAAGATGAAGATGAAGATGG
CTGGAGGGCTACAATTCGTTCTCGAATCTTTTAAGAATCAATTTACGCCACAAAATAATATTGAAATTTGGATCTATATATCAATAGTGTTAAAATATTG
GGCCCAATTAATGAGGAGGCTCCAAGAATAA
AA sequence
>Potri.015G143150.1 pacid=42775570 polypeptide=Potri.015G143150.1.p locus=Potri.015G143150 ID=Potri.015G143150.1.v4.1 annot-version=v4.1
MVHGPDPFCGIDGEKQVAGLPSDAYKRKMKMKMAGGLQFVLESFKNQFTPQNNIEIWIYISIVLKYWAQLMRRLQE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.015G143150 0 1
AT5G17230 PSY PHYTOENE SYNTHASE (.1.2.3) Potri.002G056800 1.00 0.9871
AT5G24120 ATSIG5, SIG5, S... SIGMA FACTOR 5, sigma factor E... Potri.015G022100 1.73 0.9830
AT4G27030 FADA, FAD4 FATTY ACID DESATURASE 4, fatty... Potri.001G424700 2.00 0.9847
AT3G52740 unknown protein Potri.004G202900 2.82 0.9800
AT1G51920 unknown protein Potri.001G172850 3.16 0.9666
AT5G24850 CRY3 cryptochrome 3 (.1) Potri.006G277500 8.36 0.9431
AT5G65620 Zincin-like metalloproteases f... Potri.009G151300 9.38 0.9475
AT1G45616 AtRLP6 receptor like protein 6 (.1) Potri.011G021332 9.94 0.9482
Potri.002G167500 10.09 0.9422
AT5G62680 Major facilitator superfamily ... Potri.012G071500 12.96 0.9371

Potri.015G143150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.