Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RAB11.7
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07410 380 / 4e-136 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT3G46830 373 / 4e-133 ATRAB-A2C, AtRab11A, AtRABA2c ARABIDOPSIS RAB GTPASE HOMOLOG A2C, RAB GTPase homolog A2C (.1) AT5G59150 371 / 2e-132 ATRAB-A2D, AtRABA2d ARABIDOPSIS RAB GTPASE HOMOLOG A2D, RAB GTPase homolog A2D (.1) AT1G09630 337 / 6e-119 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT4G18800 306 / 5e-107 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT5G45750 305 / 3e-106 AtRABA1c RAB GTPase homolog A1C (.1) AT1G16920 303 / 2e-105 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT5G60860 294 / 6e-102 AtRABA1f RAB GTPase homolog A1F (.1) AT1G06400 292 / 3e-101 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) AT3G15060 288 / 8e-100 AtRABA1g RAB GTPase homolog A1G (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G000300 [exp] 418 / 4e-151 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.010G197200 [exp] 358 / 3e-127 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.008G061300 [exp] 353 / 1e-125 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.003G004100 [exp] 328 / 1e-115 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.011G070300 [exp] 314 / 6e-110 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.004G061000 [exp] 309 / 5e-108 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1) Potri.001G374000 [exp] 297 / 3e-103 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1) Potri.013G123600 [exp] 295 / 2e-102 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.011G061300 [exp] 294 / 5e-102 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016486 [exp] 390 / 4e-140 AT1G07410 396 / 1e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10040745 [exp] 389 / 2e-139 AT1G07410 394 / 7e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10004687 [exp] 360 / 5e-128 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10040255 [exp] 360 / 5e-128 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10001026 [exp] 358 / 3e-127 AT1G07410 366 / 2e-130 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10041116 [exp] 326 / 1e-114 AT1G09630 395 / 4e-142 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Lus10036441 [exp] 308 / 1e-107 AT1G09630 387 / 2e-138 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Lus10029253 [exp] 303 / 2e-105 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1) Lus10007306 [exp] 297 / 4e-103 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1) Lus10002178 [exp] 297 / 4e-103 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.016G000400.2 pacid=42809938 polypeptide=Potri.016G000400.2.p locus=Potri.016G000400 ID=Potri.016G000400.2.v4.1 annot-version=v4.1 ATGGGTCATAGAGTGGATCATGAGTATGACTATCTGTTTAAGATCGTGCTGATCGGGGACTCTGGTGTTGGCAAATCCAATATTCTTTCCAGGTTTACCA GAAATGAATTCTGCTTGGAATCCAAATCCACCATAGGTGTTGAGTTTGCCACCAGAACTCTCCAAGTGGATGGGAAGACAGTAAAGGCACAGATTTGGGA TACAGCTGGTCAGGAGCGGTATCGAGCTATCACTAGTGCTTATTACAGAGGAGCTGTTGGTGCTCTTCTTGTTTATGACATAACCAAGAGGCAAACTTTC GACAATGTCCAGAGGTGGCTTCGTGAATTAAGAGACCATGCAGACTCTAACATTGTCATCATGATGGCGGGAAACAAGTCTGACTTGAAACATCTCAGGG CTGTTCTAGAGGAGGATGGTCATGCCCTGGCTGAGAAGGAAGGTCTCTCATTTCTTGAGACATCAGCGCTAGAAGCCACCAATATTGAGAAGGCGTTCCA AACCATATTGACAGAGATCTACCATATCATTAGCAAGAAAGCACTGGCAGCCCAGGAAGCAGCTGCCAATTCCACAGTTCCTGGTCAAGGAACCACTATC AATGTTGCCGATGCCTCGGGGAACACAAGCAAAGGTTGCTGTTCCACTTAA
AA sequence Show only first row Show all	>Potri.016G000400.2 pacid=42809938 polypeptide=Potri.016G000400.2.p locus=Potri.016G000400 ID=Potri.016G000400.2.v4.1 annot-version=v4.1 MGHRVDHEYDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVDGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQTF DNVQRWLRELRDHADSNIVIMMAGNKSDLKHLRAVLEEDGHALAEKEGLSFLETSALEATNIEKAFQTILTEIYHIISKKALAAQEAAANSTVPGQGTTI NVADASGNTSKGCCST

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G07410		ATRAB-A2B, AtRA...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Potri.016G000400 [exp]	0	1	RAB11.7
AT1G19010			unknown protein		Potri.017G074300 [exp]	4.69	0.8484
AT4G27190			NB-ARC domain-containing disea...		Potri.001G446966 [exp]	8.48	0.8260
					Potri.006G225133 [exp]	10.29	0.8383
AT2G01460			P-loop containing nucleoside t...		Potri.010G111900 [exp]	10.58	0.7952
AT4G09750			NAD(P)-binding Rossmann-fold s...		Potri.002G063601 [exp]	11.48	0.7782
AT4G27740			Yippee family putative zinc-bi...		Potri.015G009100 [exp]	16.73	0.8115
AT5G43990		SDG18, SUVR2	SET DOMAIN PROTEIN 18, SET-dom...		Potri.002G257400 [exp]	19.33	0.8050
AT4G27610			unknown protein		Potri.013G076900 [exp]	23.81	0.8102
AT5G54470	CO		B-box type zinc finger family ...		Potri.011G125400 [exp]	25.37	0.8009
AT1G23380	HD	KNAT6S, KNAT6L,...	KNOTTED1-like homeobox gene 6 ...		Potri.010G043500 [exp]	26.15	0.8031

Compare expression of checked genes

Potri.016G000400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.