Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56190 201 / 7e-64 Transducin/WD40 repeat-like superfamily protein (.1.2) AT1G55680 201 / 9e-64 Transducin/WD40 repeat-like superfamily protein (.1) AT3G13340 196 / 6e-62 Transducin/WD40 repeat-like superfamily protein (.1.2) AT1G78070 176 / 6e-54 Transducin/WD40 repeat-like superfamily protein (.1) AT1G36070 161 / 8e-49 Transducin/WD40 repeat-like superfamily protein (.1.2) AT2G43770 43 / 2e-05 Transducin/WD40 repeat-like superfamily protein (.1) AT1G04510 43 / 2e-05 MAC3A MOS4-associated complex 3A (.1.2) AT2G33340 43 / 3e-05 MAC3B MOS4-associated complex 3B (.1.2.3) AT5G25150 40 / 0.0002 TAF5 TBP-associated factor 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G000500 [exp] 232 / 7e-76 AT3G13340 683 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.011G168600 [exp] 212 / 5e-68 AT3G13340 736 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.001G471800 [exp] 211 / 8e-68 AT3G13340 736 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.014G147400 [exp] 178 / 4e-55 AT3G13340 605 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.002G233700 [exp] 175 / 7e-54 AT3G13340 597 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.005G168600 [exp] 171 / 4e-52 AT1G78070 649 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.002G094100 [exp] 166 / 5e-50 AT1G78070 655 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.008G171600 [exp] 45 / 3e-06 AT2G33340 830 / 0.0 MOS4-associated complex 3B (.1.2.3) Potri.010G066000 [exp] 45 / 6e-06 AT2G33340 819 / 0.0 MOS4-associated complex 3B (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037252 [exp] 216 / 2e-69 AT1G55680 685 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10035667 [exp] 216 / 2e-69 AT1G55680 684 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10041268 [exp] 182 / 2e-56 AT3G13340 605 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10021975 [exp] 182 / 3e-56 AT5G56190 617 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10041102 [exp] 169 / 3e-51 AT1G78070 622 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10036428 [exp] 162 / 1e-48 AT1G78070 598 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10014477 [exp] 47 / 1e-06 AT2G33340 784 / 0.0 MOS4-associated complex 3B (.1.2.3) Lus10023728 [exp] 45 / 5e-06 AT2G33340 786 / 0.0 MOS4-associated complex 3B (.1.2.3) Lus10002860 [exp] 45 / 6e-06 AT2G43770 617 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10012230 [exp] 44 / 1e-05 AT2G43770 620 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.016G000800.1 pacid=42810555 polypeptide=Potri.016G000800.1.p locus=Potri.016G000800 ID=Potri.016G000800.1.v4.1 annot-version=v4.1 ATGGCGTCCTTGTTATTGCAGCCCATGGTGTCTCTATGTGGACAGGTGGATTTCTCATTTGCATCTGCTTGGCATCCTGAAGGCCGCATTTTTGCCACGG GGAACCAAGACAAACCCTGTCTTATTTGGGATGCTCGAAACTTGTCAAAGTCTGTTGCTGTGCTGAAGGGCAATCTAGGAGCCATTAGATCAACTCGTTT TACATCTGATGGGCAGTTCATGGCGATGGAAGAGCCGGCAGACTTTTGCATGTGTATGATACGAAGGTTTGAGAAAGAGCAGGAGAGAGACTTTTTTGGG GAGATCTCTGTTGTATCTTTTAGCCCTGATACAGAATCCCTCTTTATAGGAGTGTGGGATCGCAACTATGGAAGCCTCTTTCAGTACAACCGATGCAGGA GTTACTCATATCTCGACTCCCTTATGTGA
AA sequence Show only first row Show all	>Potri.016G000800.1 pacid=42810555 polypeptide=Potri.016G000800.1.p locus=Potri.016G000800 ID=Potri.016G000800.1.v4.1 annot-version=v4.1 MASLLLQPMVSLCGQVDFSFASAWHPEGRIFATGNQDKPCLIWDARNLSKSVAVLKGNLGAIRSTRFTSDGQFMAMEEPADFCMCMIRRFEKEQERDFFG EISVVSFSPDTESLFIGVWDRNYGSLFQYNRCRSYSYLDSLM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G56190			Transducin/WD40 repeat-like su...		Potri.016G000800 [exp]	0	1
AT1G67540			unknown protein		Potri.010G057800 [exp]	1.41	0.9082
AT5G06900		CYP93D1	"cytochrome P450, family 93, s...		Potri.016G049900 [exp]	5.09	0.9023
AT4G18100			Ribosomal protein L32e (.1)		Potri.011G078200 [exp]	10.00	0.8611	RPL32.1
AT3G48480			Cysteine proteinases superfami...		Potri.015G090800 [exp]	17.23	0.8750
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Potri.005G143800 [exp]	19.23	0.8239	CYP81S7,CYP81.2
AT3G18680			Amino acid kinase family prote...		Potri.007G110201 [exp]	22.91	0.8606
AT1G10280			Core-2/I-branching beta-1,6-N-...		Potri.004G228100 [exp]	23.10	0.8853
					Potri.001G426980 [exp]	24.81	0.8408
AT1G16020			Protein of unknown function (D...		Potri.008G137000 [exp]	26.26	0.8050
AT2G26530		AR781	Protein of unknown function (D...		Potri.001G274000 [exp]	28.00	0.8827

Compare expression of checked genes

Potri.016G000800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.