Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G01060 318 / 6e-109 GARP myb-like HTH transcriptional regulator family protein (.1.2) AT3G13040 133 / 2e-35 GARP myb-like HTH transcriptional regulator family protein (.1.2) AT3G04450 128 / 5e-34 GARP Homeodomain-like superfamily protein (.1.2) AT3G24120 125 / 1e-33 GARP Homeodomain-like superfamily protein (.1.2) AT4G28610 127 / 2e-33 GARP ATPHR1, PHR1 phosphate starvation response 1 (.1) AT4G13640 124 / 3e-33 GARP UNE16 unfertilized embryo sac 16, Homeodomain-like superfamily protein (.1.2) AT5G29000 125 / 6e-33 GARP PHL1 PHR1-like 1, Homeodomain-like superfamily protein (.1.2.3.4) AT1G79430 123 / 3e-32 GARP WDY, APL WOODY, ALTERED PHLOEM DEVELOPMENT, Homeodomain-like superfamily protein (.1.2) AT5G06800 121 / 1e-31 GARP myb-like HTH transcriptional regulator family protein (.1.2) AT1G69580 120 / 1e-31 GARP Homeodomain-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G000800 [exp] 482 / 7e-173 AT2G01060 321 / 1e-109 myb-like HTH transcriptional regulator family protein (.1.2) Potri.006G101000 [exp] 149 / 3e-43 AT2G01060 179 / 2e-55 myb-like HTH transcriptional regulator family protein (.1.2) Potri.016G117000 [exp] 140 / 7e-40 AT2G01060 173 / 4e-53 myb-like HTH transcriptional regulator family protein (.1.2) Potri.007G003200 [exp] 144 / 2e-39 AT3G13040 330 / 1e-108 myb-like HTH transcriptional regulator family protein (.1.2) Potri.014G000700 [exp] 141 / 2e-38 AT3G13040 308 / 6e-101 myb-like HTH transcriptional regulator family protein (.1.2) Potri.001G314800 [exp] 130 / 1e-35 AT4G13640 345 / 2e-119 unfertilized embryo sac 16, Homeodomain-like superfamily protein (.1.2) Potri.019G020900 [exp] 131 / 7e-35 AT5G29000 306 / 4e-101 PHR1-like 1, Homeodomain-like superfamily protein (.1.2.3.4) Potri.017G054800 [exp] 127 / 2e-34 AT4G13640 338 / 6e-117 unfertilized embryo sac 16, Homeodomain-like superfamily protein (.1.2) Potri.013G048000 [exp] 128 / 1e-33 AT5G29000 321 / 4e-106 PHR1-like 1, Homeodomain-like superfamily protein (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038734 [exp] 328 / 5e-113 AT2G01060 324 / 1e-111 myb-like HTH transcriptional regulator family protein (.1.2) Lus10039124 [exp] 325 / 2e-111 AT2G01060 350 / 6e-122 myb-like HTH transcriptional regulator family protein (.1.2) Lus10005036 [exp] 139 / 2e-39 AT2G01060 175 / 4e-54 myb-like HTH transcriptional regulator family protein (.1.2) Lus10027806 [exp] 138 / 3e-39 AT2G01060 172 / 6e-53 myb-like HTH transcriptional regulator family protein (.1.2) Lus10004809 [exp] 136 / 4e-38 AT2G01060 171 / 5e-52 myb-like HTH transcriptional regulator family protein (.1.2) Lus10002483 [exp] 133 / 7e-37 AT2G01060 168 / 6e-51 myb-like HTH transcriptional regulator family protein (.1.2) Lus10008197 [exp] 131 / 7e-35 AT5G29000 318 / 3e-105 PHR1-like 1, Homeodomain-like superfamily protein (.1.2.3.4) Lus10037296 [exp] 130 / 5e-34 AT3G13040 364 / 5e-122 myb-like HTH transcriptional regulator family protein (.1.2) Lus10035705 [exp] 130 / 6e-34 AT3G13040 372 / 4e-125 myb-like HTH transcriptional regulator family protein (.1.2) Lus10024938 [exp] 128 / 1e-33 AT4G28610 314 / 2e-103 phosphate starvation response 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF14379 [poplar] [flax] Myb_CC_LHEQLE MYB-CC type transfactor, LHEQLE motif
Representative CDS sequence Show only first row Show all	>Potri.016G001100.1 pacid=42809664 polypeptide=Potri.016G001100.1.p locus=Potri.016G001100 ID=Potri.016G001100.1.v4.1 annot-version=v4.1 ATGGATCTGGATTGTGAAGCTATGACAATGGATCCCATCAATGGAGGGAACAGTCTCAACAACAATCCTAATCTTGCCTCAAAGCAACGATTGCGTTGGA CTCATGAGCTTCACGAACGCTTTGTTGATGCTGTGGCTCAGCTTGGTGGGCCAGATCGGGCTACACCTAAAGGTGTTCTCAGAGTCATGGGTGTGCAAGG CTTAACAATTTACCATGTTAAAAGCCATTTACAGAAATATCGACTTGCAAAATACCTTCCCGACTCCTCATCCGATGGGAAAAAAGTGGACAAGAAGGAA ACAGGGGATGTGCTTTCCAATTCGGATGGTTCTTCTGGAATGCAAATTACAGAAGCACTCAAGCTGCAGATGGAGGTGCAAAAGCGTCTACATGAGCAAT TGGAGGTGCAGAGACAGCTACAATTACGCATAGAAGCCCAAGGGAAGTATTTGAAGAAGATAATTGAAGAGCAACAACGATTGAGCGGAGTTCTTGAAGA TGTGCCTGGTTCAGGGGTCTCTGCCCCAGTATCAGGTGACAACTGCCCAGTATCTGACAACAAAACAGACCCAGCAACCCCTGCCCCAACTTCTGAATCA CCCCTCCAAGACAAGGTTGCCAAGGAATGTGCCCCAACAAAGAGCCTTTCAATTGATGAATCATTCTCCTCTCAGCACGAGCCATTAACACCAGATTCAC GTTGCAATACTGGTTCCCCAGCAGAGAGCCCTAGAGGTGAGAGGTCACTGAAGAAGCAAATGGTAAGCATGGGTGTAGCATTTGGTAAACCAGAGATGGT TCTTACACACCAGATATTGGAGTCGAGCTTAAATTCCTATCCACAACCGCACTCTGCCTTCTTGACCAGAGAGCAATTCGATCCTTCATCTGGGTTATCA ATGGGAAACGAAGATCAATCGGAGGTCTTAGGCAGTGACCTTTAG
AA sequence Show only first row Show all	>Potri.016G001100.1 pacid=42809664 polypeptide=Potri.016G001100.1.p locus=Potri.016G001100 ID=Potri.016G001100.1.v4.1 annot-version=v4.1 MDLDCEAMTMDPINGGNSLNNNPNLASKQRLRWTHELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLPDSSSDGKKVDKKE TGDVLSNSDGSSGMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLEDVPGSGVSAPVSGDNCPVSDNKTDPATPAPTSES PLQDKVAKECAPTKSLSIDESFSSQHEPLTPDSRCNTGSPAESPRGERSLKKQMVSMGVAFGKPEMVLTHQILESSLNSYPQPHSAFLTREQFDPSSGLS MGNEDQSEVLGSDL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G01060	GARP		myb-like HTH transcriptional r...		Potri.016G001100 [exp]	0	1
AT3G16350	MYB		Homeodomain-like superfamily p...		Potri.001G189800 [exp]	3.31	0.8416
AT3G09670			Tudor/PWWP/MBT superfamily pro...		Potri.006G131800 [exp]	8.48	0.8173
AT3G27700	C3HZnF		zinc finger (CCCH-type) family...		Potri.017G072100 [exp]	8.48	0.8000
AT1G13190			RNA-binding (RRM/RBD/RNP motif...		Potri.008G182500 [exp]	12.36	0.7812
AT2G19130			S-locus lectin protein kinase ...		Potri.013G121550 [exp]	21.49	0.7526
AT3G04470			Ankyrin repeat family protein ...		Potri.013G047500 [exp]	21.63	0.7653
AT1G11050			Protein kinase superfamily pro...		Potri.017G132250 [exp]	23.06	0.7720
AT3G09670			Tudor/PWWP/MBT superfamily pro...		Potri.016G085500 [exp]	24.14	0.7780
AT3G26890			unknown protein		Potri.015G103500 [exp]	24.24	0.7114
AT2G29970			Double Clp-N motif-containing ...		Potri.001G252500 [exp]	26.83	0.7534

Compare expression of checked genes

Potri.016G001100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.