Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64620 82 / 1e-19 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1) AT2G31430 51 / 4e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17220 43 / 4e-05 ATPMEI2 pectin methylesterase inhibitor 2 (.1) AT1G09370 40 / 0.0004 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G013400 [exp] 160 / 4e-50 AT5G64620 66 / 8e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.005G007100 [exp] 61 / 1e-11 AT1G09360 85 / 6e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.007G108301 [exp] 60 / 2e-11 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.002G191500 [exp] 51 / 4e-08 AT2G31430 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G127500 [exp] 50 / 8e-08 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.014G044100 [exp] 44 / 1e-05 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.009G083500 [exp] 44 / 1e-05 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038738 [exp] 127 / 2e-37 AT5G64620 67 / 4e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10039120 [exp] 122 / 2e-35 AT5G64620 69 / 5e-15 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10038737 [exp] 59 / 6e-11 AT5G64620 56 / 7e-10 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10022409 [exp] 53 / 1e-08 AT5G64620 155 / 3e-48 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10000822 [exp] 49 / 3e-07 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10027947 [exp] 47 / 9e-07 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10003530 [exp] 42 / 6e-05 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10002933 [exp] 42 / 7e-05 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016318 [exp] 40 / 0.0003 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.016G001600.1 pacid=42809821 polypeptide=Potri.016G001600.1.p locus=Potri.016G001600 ID=Potri.016G001600.1.v4.1 annot-version=v4.1 ATGGTGTCTCGCCCCTCCCCCCCTCGTCTTCTTCACTCTATCTCCTTGTTGCTACTTCTTCTTCTCTCCATATTCCATGCCTCTGATGCAGCGACTGCCC TAGTGGACAAGGTTTGCAAACAAACTTCAAGTTATCCATTCTGCGTGCGCTCTCTCTACTCTGACTCGCGAACCCCAGAAGCTGATGAGTACACGCTGGC TTACATTTCAGTTGGGGTAGCTTACAACAACGCTACCTCCACCCAACATTACATATCTGATCAGCTCAGGTCAATCAAGGTCAATGGCTCTACCCACCAC GATCAGCAGCAGCGTCTCCAAATGTGTAGCCGCGGTTACCAAAGGGCTGTTTCAGCTCTGGCAATGGCCCACAATGACCTGGACTCCGAGACCTTCTTCG AATTGGCTAGGCTGGCAGCCAAAGCCTCTAGCGGTGCTAATGATTGCAAGGCTGCTTTCAAGGGAATTCCTTCACCAACAGCACTAGCCAAAGGGAACCA AGACTTGGTGTATCTTTGTGAAATTTGTGGTGTTGTTGCTAAATTATTTACTAGAATGTGA
AA sequence Show only first row Show all	>Potri.016G001600.1 pacid=42809821 polypeptide=Potri.016G001600.1.p locus=Potri.016G001600 ID=Potri.016G001600.1.v4.1 annot-version=v4.1 MVSRPSPPRLLHSISLLLLLLLSIFHASDAATALVDKVCKQTSSYPFCVRSLYSDSRTPEADEYTLAYISVGVAYNNATSTQHYISDQLRSIKVNGSTHH DQQQRLQMCSRGYQRAVSALAMAHNDLDSETFFELARLAAKASSGANDCKAAFKGIPSPTALAKGNQDLVYLCEICGVVAKLFTRM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G64620		ATC/VIF2, C/VIF...	cell wall / vacuolar inhibitor...		Potri.016G001600 [exp]	0	1
AT1G72930		TIR	toll/interleukin-1 receptor-li...		Potri.005G004366 [exp]	1.73	0.7424
AT5G50335			unknown protein		Potri.012G094000 [exp]	5.65	0.7259
AT5G06730			Peroxidase superfamily protein...		Potri.001G012901 [exp]	13.41	0.6978
AT2G30130	AS2	PCK1, LBD12, AS...	PEACOCK 1, Lateral organ bound...		Potri.010G184400 [exp]	14.96	0.6827
AT1G03940			HXXXD-type acyl-transferase fa...		Potri.019G118000 [exp]	18.16	0.6969
AT1G16040			unknown protein		Potri.003G184701 [exp]	20.07	0.6745
AT3G49120		PRX34, PRXCB, A...	PEROXIDASE 34, ARABIDOPSIS THA...		Potri.001G011200 [exp]	21.56	0.6201
AT5G20820			SAUR-like auxin-responsive pro...		Potri.006G137000 [exp]	22.49	0.6413	SAUR6
AT2G41380			S-adenosyl-L-methionine-depend...		Potri.016G039051 [exp]	25.69	0.6791
AT1G14550			Peroxidase superfamily protein...		Potri.010G236890 [exp]	26.15	0.6564

Compare expression of checked genes

Potri.016G001600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.