Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RAB2.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G17170 395 / 5e-142 ATRAB-B1B, AT-RAB2, AtRABB1c, AtRab2A ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1) AT4G35860 362 / 4e-129 ATGB2, AtRABB1b, Atrab2C GTP-binding 2 (.1.2) AT4G17160 330 / 9e-117 AtRab2B, AtRABB1a RAB GTPase homolog B1A (.1) AT5G45750 198 / 2e-64 AtRABA1c RAB GTPase homolog A1C (.1) AT5G60860 197 / 6e-64 AtRABA1f RAB GTPase homolog A1F (.1) AT3G12160 196 / 2e-63 AtRABA4d ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) AT4G18430 196 / 3e-63 AtRABA1e RAB GTPase homolog A1E (.1) AT1G16920 195 / 5e-63 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT5G47960 193 / 2e-62 SMG1, AtRABA4c SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1) AT2G33870 193 / 2e-62 ArRABA1h RAB GTPase homolog A1H (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G159600 [exp] 361 / 7e-129 AT4G35860 412 / 7e-149 GTP-binding 2 (.1.2) Potri.011G070300 [exp] 199 / 2e-64 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.011G061300 [exp] 197 / 4e-64 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1) Potri.001G270100 [exp] 197 / 5e-64 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.004G061000 [exp] 195 / 3e-63 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1) Potri.001G374000 [exp] 195 / 5e-63 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1) Potri.013G123600 [exp] 194 / 1e-62 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.019G092500 [exp] 194 / 1e-62 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.007G096000 [exp] 193 / 2e-62 AT5G65270 404 / 2e-145 RAB GTPase homolog A4A (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038744 [exp] 399 / 8e-144 AT4G17170 434 / 2e-157 ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1) Lus10039114 [exp] 373 / 3e-133 AT4G17170 407 / 5e-147 ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1) Lus10025184 [exp] 363 / 1e-129 AT4G17170 389 / 1e-139 ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1) Lus10016066 [exp] 340 / 4e-120 AT4G17170 369 / 3e-131 ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1) Lus10029253 [exp] 199 / 1e-64 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1) Lus10020746 [exp] 198 / 3e-64 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) Lus10015297 [exp] 197 / 5e-64 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1) Lus10025432 [exp] 197 / 6e-64 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1) Lus10002178 [exp] 197 / 9e-64 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1) Lus10017679 [exp] 196 / 1e-63 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.016G002200.2 pacid=42810292 polypeptide=Potri.016G002200.2.p locus=Potri.016G002200 ID=Potri.016G002200.2.v4.1 annot-version=v4.1 ATGTCTTACGCTTATCTCTTCAAGTACATCATCATCGGCGACACTGGAGTAGGGAAATCGTGCTTGCTGCTGCAATTCACGGACAAGAGATTCCAGCCGG TGCATGACCTTACCATCGGTGTTGAGTTTGGGGCTCGTATGATCACCATTGATAACAAGCCTATCAAACTCCAAATTTGGGACACCGCGGGTCAAGAGTC GTTTAGATCCATAACCAGGTCTTATTACAGAGGTGCTGCCGGTGCTTTGCTTGTCTATGATATTACCAGGAGGGAAACTTTTAATCACTTGGCGAGCTGG CTGGAAGATGCAAGGCAGCATGCCAATGCAAACATGACCATTATGCTCATTGGTAATAAGTCTGATCTTGCTCATAGAAGGGCTGTCAGCACTGAAGAAG GTGAGCAGTTTGCAAAGGAGCATGGCTTGATCTTCATGGAGGCCTCTGCAAAAACTGCTCAGAATGTCGAGGAGGCTTTTATCAAAACAGCTGCAACTAT ATATAAGAAGATTCAAGATGGAGTTTTTGATGTATCAAATGAGTCTTATGGGATAAAAGTTGGATATGGAGGTATTCCAGGGTCATCAGGAGGCAGGGAT GGTGCTTCTGCCCAAGCTGGAGGCTGTTGCAGTTGA
AA sequence Show only first row Show all	>Potri.016G002200.2 pacid=42810292 polypeptide=Potri.016G002200.2.p locus=Potri.016G002200 ID=Potri.016G002200.2.v4.1 annot-version=v4.1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLASW LEDARQHANANMTIMLIGNKSDLAHRRAVSTEEGEQFAKEHGLIFMEASAKTAQNVEEAFIKTAATIYKKIQDGVFDVSNESYGIKVGYGGIPGSSGGRD GASAQAGGCCS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G17170		ATRAB-B1B, AT-R...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Potri.016G002200 [exp]	0	1	RAB2.1
AT4G14965		ATMAPR4	membrane-associated progestero...		Potri.016G022700 [exp]	1.73	0.6808
AT1G55265			Protein of unknown function, D...		Potri.003G217300 [exp]	8.77	0.6545
AT4G36800		RCE1	RUB1 conjugating enzyme 1 (.1....		Potri.005G126500 [exp]	10.48	0.6740
AT2G39445			Phosphatidylinositol N-acetylg...		Potri.002G134800 [exp]	15.87	0.6615
AT4G27750		ISI1	IMPAIRED SUCROSE INDUCTION 1, ...		Potri.015G029300 [exp]	17.20	0.5735
AT5G59140			BTB/POZ domain-containing prot...		Potri.009G037800 [exp]	19.89	0.6270
AT1G58807			Disease resistance protein (CC...		Potri.012G121775 [exp]	25.49	0.5132
AT4G30820			cyclin-dependent kinase-activa...		Potri.018G103200 [exp]	27.74	0.6196
AT2G38130		ATMAK3	Acyl-CoA N-acyltransferases (N...		Potri.001G429200 [exp]	28.77	0.6034
AT4G20380		LSD1	LESION SIMULATING DISEASE, LSD...		Potri.001G442400 [exp]	28.87	0.6704	LSD1.1

Compare expression of checked genes

Potri.016G002200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.