Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G05030 73 / 2e-18 Copper transport protein family (.1) AT3G20180 54 / 5e-11 Copper transport protein family (.1) AT1G55790 45 / 5e-07 Domain of unknown function (DUF2431) (.1), Domain of unknown function (DUF2431) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G001900 [exp] 91 / 4e-26 AT4G05030 88 / 3e-24 Copper transport protein family (.1) Potri.006G001800 [exp] 91 / 4e-26 AT4G05030 73 / 2e-18 Copper transport protein family (.1) Potri.001G468500 [exp] 66 / 5e-16 AT4G05030 65 / 1e-14 Copper transport protein family (.1) Potri.006G002000 [exp] 59 / 1e-13 AT4G05030 54 / 3e-11 Copper transport protein family (.1) Potri.001G378700 [exp] 56 / 1e-11 AT3G20180 56 / 5e-11 Copper transport protein family (.1) Potri.014G171300 [exp] 51 / 6e-10 AT3G07600 75 / 5e-18 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171500 [exp] 50 / 2e-09 AT3G07600 73 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048300 [exp] 49 / 5e-09 AT3G07600 80 / 4e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048100 [exp] 47 / 1e-08 AT3G07600 79 / 8e-20 Heavy metal transport/detoxification superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025179 [exp] 61 / 1e-13 AT4G05030 62 / 1e-13 Copper transport protein family (.1) Lus10016059 [exp] 59 / 4e-13 AT4G05030 62 / 2e-13 Copper transport protein family (.1) Lus10038769 [exp] 52 / 3e-10 AT4G05030 76 / 3e-19 Copper transport protein family (.1) Lus10039093 [exp] 51 / 3e-10 AT4G05030 72 / 3e-18 Copper transport protein family (.1) Lus10016060 [exp] 50 / 2e-09 AT3G07600 64 / 9e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10016062 [exp] 47 / 1e-08 AT5G48290 89 / 2e-23 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025180 [exp] 46 / 3e-08 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025181 [exp] 45 / 1e-07 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016061 [exp] 45 / 1e-07 AT5G48290 82 / 1e-20 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.016G002600.2 pacid=42809186 polypeptide=Potri.016G002600.2.p locus=Potri.016G002600 ID=Potri.016G002600.2.v4.1 annot-version=v4.1 ATGAATTGTGAGAAATGTAGGACTAAGGCACTCAAGGTTGTGGCAGATGCGGATGGTGTGAGTTTTATGGGATTAGAAGGTGAGAAGAAAGAAGATATTG TGGTGGTGATTGGAGAAGGAGTTGATGCTGCCAAGTTAGCCAGCAGCTTAATGAAGAAAGTTGGGCATACTGACATTGTCTCAGTGTTGCATGAGTATTA G
AA sequence Show only first row Show all	>Potri.016G002600.2 pacid=42809186 polypeptide=Potri.016G002600.2.p locus=Potri.016G002600 ID=Potri.016G002600.2.v4.1 annot-version=v4.1 MNCEKCRTKALKVVADADGVSFMGLEGEKKEDIVVVIGEGVDAAKLASSLMKKVGHTDIVSVLHEY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G05030			Copper transport protein famil...		Potri.016G002600 [exp]	0	1
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Potri.019G004500 [exp]	6.48	0.9841	QLEG.3
AT4G31970		CYP82C2, JAH1	"cytochrome P450, family 82, s...		Potri.009G108766 [exp]	10.95	0.9757
AT5G63520			unknown protein		Potri.012G100600 [exp]	11.22	0.9791
AT2G15620		ATHNIR, NIR1	ARABIDOPSIS THALIANA NITRITE R...		Potri.009G101600 [exp]	12.00	0.9741
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Potri.019G004400 [exp]	17.23	0.9777
AT4G37060		AtPLAIVB, PLP5,...	phospholipase A IVB, PATATIN-l...		Potri.019G014401 [exp]	19.49	0.9738
AT2G30070		ATKUP1, ATKT1P,...	POTASSIUM UPTAKE TRANSPORTER 1...		Potri.007G068200 [exp]	19.77	0.9744
AT5G60740		ABCG28	ATP-binding cassette G28, ABC ...		Potri.001G058900 [exp]	20.97	0.9635
AT1G54870			NAD(P)-binding Rossmann-fold s...		Potri.010G092400 [exp]	25.09	0.9736
AT2G37460			nodulin MtN21 /EamA-like trans...		Potri.006G082700 [exp]	26.49	0.9654

Compare expression of checked genes

Potri.016G002600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.