Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47770 173 / 3e-54 FPS1 farnesyl diphosphate synthase 1 (.1) AT4G17190 166 / 8e-53 FPS2 farnesyl diphosphate synthase 2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G003400 [exp] 202 / 9e-66 AT5G47770 588 / 0.0 farnesyl diphosphate synthase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006168 [exp] 198 / 4e-64 AT5G47770 575 / 0.0 farnesyl diphosphate synthase 1 (.1) Lus10041057 [exp] 194 / 7e-63 AT5G47770 565 / 0.0 farnesyl diphosphate synthase 1 (.1) Lus10022545 [exp] 133 / 8e-39 AT4G17190 444 / 3e-157 farnesyl diphosphate synthase 2 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0613 [poplar] [flax] Terp_synthase PF00348 [poplar] [flax] polyprenyl_synt Polyprenyl synthetase
Representative CDS sequence Show only first row Show all	>Potri.016G004100.6 pacid=42809302 polypeptide=Potri.016G004100.6.p locus=Potri.016G004100 ID=Potri.016G004100.6.v4.1 annot-version=v4.1 ATGGGAACCTACTTCCAAGTACAGGATGATTGCTTGGATTGCTTTGGTGATCCAGAGATAATTGGTAAGATACGAACAGATATTGAAGATTTTAAGTGCT CTTGGTTGGTTGTGAAGGGTATGGAGATATGCAATGAAGAGCAAAAGAAACTGTTACATGAAAACTATGGGAAACCTGACCCAGCAAATGAAGCACAAGG GAAGGCCCTCTATAATGATCTGAACCTTCAGGGTGTATTTGCGGATTACGAGAGCAAAACCTATGAGAAGCTGATAACTTCTATTGAAGATCATCCTAGC AAAGCAGTGTTGAAGTCCTTCTTGGCTAAAATTTACCAGAGGCAGAAATAG
AA sequence Show only first row Show all	>Potri.016G004100.6 pacid=42809302 polypeptide=Potri.016G004100.6.p locus=Potri.016G004100 ID=Potri.016G004100.6.v4.1 annot-version=v4.1 MGTYFQVQDDCLDCFGDPEIIGKIRTDIEDFKCSWLVVKGMEICNEEQKKLLHENYGKPDPANEAQGKALYNDLNLQGVFADYESKTYEKLITSIEDHPS KAVLKSFLAKIYQRQK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G47770		FPS1	farnesyl diphosphate synthase ...		Potri.016G004100 [exp]	0	1
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Potri.002G064632 [exp]	1.41	0.7893
AT1G14685	BBR_BPC	BBR/BPC2, ATBPC...	basic pentacysteine 2 (.1.2.3)		Potri.012G040800 [exp]	11.57	0.7980
AT4G23630		RTNLB1, BTI1	Reticulan like protein B1, VIR...		Potri.012G035600 [exp]	21.63	0.7693
AT1G02460			Pectin lyase-like superfamily ...		Potri.013G005000 [exp]	28.49	0.7044
AT5G51600		ATMAP65-3, PLE	PLEIADE, ARABIDOPSIS THALIANA ...		Potri.006G269800 [exp]	45.59	0.7670
AT3G52460			hydroxyproline-rich glycoprote...		Potri.016G071200 [exp]	56.49	0.6720
AT2G26060		EMB1345	embryo defective 1345, Transdu...		Potri.001G221150 [exp]	61.95	0.7559
AT2G36530		ENO2, LOS2	LOW EXPRESSION OF OSMOTICALLY ...		Potri.012G129300 [exp]	104.49	0.7415
AT2G17790		ZIP3, VPS35A	ZIG suppressor 3, VPS35 homolo...		Potri.007G061540 [exp]	109.59	0.7178
AT2G40220	AP2_ERF	ATABI4, GIN6, S...	SUCROSE UNCOUPLED 6, SUGAR-INS...		Potri.008G071100 [exp]	115.75	0.6717	DREB1,Pt-ABI4.1

Compare expression of checked genes

Potri.016G004100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.