Potri.016G004700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.016G004700.2 pacid=42810011 polypeptide=Potri.016G004700.2.p locus=Potri.016G004700 ID=Potri.016G004700.2.v4.1 annot-version=v4.1
ATGGGGTTTAGCTATTTCTCGTACGACCAAGAATATGCTGATAGAATATTGCAAGGGAAACAAATCATACCATCTATTACTCTCTTTCATGTGTTCAACT
ATGATGATTTTTACGATGTCTACAGCACTGATCATGGCAATGAAGAAGCATGCGAGACAGTAGTGAACAATACTAATGTGTTCAATTACCATGATTATTT
TTATGATGTCTACGAACCATTCGAGATAGATTGGAGTTATTTCGATGAGTTAGTGGCTGAATTATGTGAGGAGCTTGAGTTAACAATACTGGAGAAACCT
CTAATGAAGGATGATGGTGCTGCTGTTGTCCACCATGATGATGGAGTTGACGAGGTTGAGGGTGAGATTATTCTTTGGAGGCCTGCCGCTGGCCTGAAGT
AG
AA sequence
>Potri.016G004700.2 pacid=42810011 polypeptide=Potri.016G004700.2.p locus=Potri.016G004700 ID=Potri.016G004700.2.v4.1 annot-version=v4.1
MGFSYFSYDQEYADRILQGKQIIPSITLFHVFNYDDFYDVYSTDHGNEEACETVVNNTNVFNYHDYFYDVYEPFEIDWSYFDELVAELCEELELTILEKP
LMKDDGAAVVHHDDGVDEVEGEIILWRPAAGLK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.016G004700 0 1
AT1G69390 ARC12, ATMINE1 accumulation and replication o... Potri.017G088401 2.82 0.5899
AT3G01570 Oleosin family protein (.1) Potri.001G345800 8.12 0.6052
AT1G67980 CCOAMT caffeoyl-CoA 3-O-methyltransfe... Potri.010G104400 10.67 0.5508 CAML3
Potri.010G161901 42.44 0.5201
Potri.016G095001 68.29 0.4757
AT1G16930 F-box/RNI-like/FBD-like domain... Potri.011G121400 69.71 0.4674
AT4G39490 CYP96A10 "cytochrome P450, family 96, s... Potri.001G397900 70.83 0.5284
Potri.002G093000 73.52 0.4503
Potri.017G071366 84.85 0.4730
Potri.010G084600 90.30 0.5199

Potri.016G004700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.