Potri.016G006700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16380 45 / 1e-05 Heavy metal transport/detoxification superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G019100 70 / 3e-14 AT4G16380 59 / 8e-10 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019200 60 / 4e-11 AT4G16380 86 / 3e-20 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019300 59 / 3e-10 AT4G16380 94 / 1e-22 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G018901 57 / 3e-10 AT4G16380 81 / 1e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019700 54 / 4e-09 AT4G16380 76 / 4e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G020100 54 / 4e-09 AT4G16380 76 / 7e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G018400 53 / 1e-08 AT4G16380 81 / 9e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019500 52 / 2e-08 AT4G16380 78 / 7e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019800 52 / 3e-08 AT4G16380 82 / 6e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039073 50 / 8e-08 AT4G16380 103 / 2e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10038786 50 / 2e-07 AT1G49420 108 / 1e-28 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.016G006700.2 pacid=42809972 polypeptide=Potri.016G006700.2.p locus=Potri.016G006700 ID=Potri.016G006700.2.v4.1 annot-version=v4.1
ATGGCAGAAAAGGTCACAACAATGGTGATCAGGGTTGATCTTGAATGTAAGAAATGCCGCAAGAAGATCAAGAAAGTGCTGTGTAAAATCCCTCAAATTC
ACAACCAGATATATGACACGAAGGCATGCACAGTGACAATCACTGTGGTTAGCTGCTGTCCTGAAAAGATCAAGAACAAGATCTGCTGCAAAGGAGGTAA
GGCTGTCAAGTGCATTGAGATCAAGGTGCCAGAAAAGCCTAAACCACCAGAGAAGCCTAAAGAACCAGAAAAACCTAAGCAACCAGAGAAGCCCAAAGAA
CCTGAGAAGCCTAAGGAACCAGAGAAGCCTAAAGAACCTCCACCGGCCCCGAAACCAGCTCCGAAACCCGCTCCTCCACCGCCGGTTCCATGCCCGCCAC
CGGTCTACCCAAGGACATGTTGTAGTGAATGCTATCAAGGGTTTGGTGGAGGCCCATGTTACCATGGTTATGGCGGGCCAGCTCCCCATTATGAACCTTA
TGGAAGGCCAGTGTATGATAGTTGGGGTGGTGGTGGATGTAGCTGCCAAAGAAGTGGTTATTATGTGTGTAGATGTAATTATGTTTCTGATCATAACCCC
TCTTCATGCAGAATCATGTGA
AA sequence
>Potri.016G006700.2 pacid=42809972 polypeptide=Potri.016G006700.2.p locus=Potri.016G006700 ID=Potri.016G006700.2.v4.1 annot-version=v4.1
MAEKVTTMVIRVDLECKKCRKKIKKVLCKIPQIHNQIYDTKACTVTITVVSCCPEKIKNKICCKGGKAVKCIEIKVPEKPKPPEKPKEPEKPKQPEKPKE
PEKPKEPEKPKEPPPAPKPAPKPAPPPPVPCPPPVYPRTCCSECYQGFGGGPCYHGYGGPAPHYEPYGRPVYDSWGGGGCSCQRSGYYVCRCNYVSDHNP
SSCRIM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G16380 Heavy metal transport/detoxifi... Potri.016G006700 0 1
AT1G22610 C2 calcium/lipid-binding plant... Potri.013G107700 1.41 0.7947
AT4G32010 B3 HSL1, HSI2-L1, ... VP1/ABI3-LIKE 2, HSI2-like 1 (... Potri.016G136500 5.74 0.8044
AT1G68670 GARP myb-like transcription factor ... Potri.008G117500 9.79 0.6987
AT2G28250 NCRK Protein kinase superfamily pro... Potri.004G212600 12.36 0.7920
AT4G34610 HD BLH6 BEL1-like homeodomain 6 (.1.2) Potri.004G159300 12.72 0.7228
AT3G21530 DNAse I-like superfamily prote... Potri.008G198100 14.14 0.7917
AT3G48890 MSBP2, ATMP2, A... MEMBRANE STEROID BINDING PROTE... Potri.015G125100 14.28 0.7276 Pt-MP2.1
AT2G17760 Eukaryotic aspartyl protease f... Potri.005G108700 16.43 0.7587
AT5G03760 ATCSLA9, RAT4, ... RESISTANT TO AGROBACTERIUM TRA... Potri.010G234100 18.73 0.7592 MANS.2
AT4G04960 Concanavalin A-like lectin pro... Potri.011G053100 19.59 0.7479

Potri.016G006700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.