Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13310 64 / 8e-12 CYP71A20 "cytochrome P450, family 71, subfamily A, polypeptide 20", cytochrome P450, family 71, subfamily A, polypeptide 20 (.1.2) AT4G13290 62 / 3e-11 CYP71A19 "cytochrome P450, family 71, subfamily A, polypeptide 19", cytochrome P450, family 71, subfamily A, polypeptide 19 (.1) AT5G42590 61 / 1e-10 MRO, CYP71A16 marneral oxidase, cytochrome P450, family 71, subfamily A, polypeptide 16 (.1) AT5G25140 59 / 5e-10 CYP71B13 "cytochrome P450, family 71, subfamily B, polypeptide 13", cytochrome P450, family 71, subfamily B, polypeptide 13 (.1) AT5G25180 58 / 1e-09 CYP71B14 "cytochrome P450, family 71, subfamily B, polypeptide 14", cytochrome P450, family 71, subfamily B, polypeptide 14 (.1) AT3G26320 55 / 1e-08 CYP71B36 "cytochrome P450, family 71, subfamily B, polypeptide 36", cytochrome P450, family 71, subfamily B, polypeptide 36 (.1) AT5G25120 54 / 3e-08 CYP71B11 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) AT3G48300 54 / 3e-08 CYP71A23 "cytochrome P450, family 71, subfamily A, polypeptide 23", cytochrome P450, family 71, subfamily A, polypeptide 23 (.1) AT3G48270 53 / 5e-08 CYP71A26 "cytochrome P450, family 71, subfamily A, polypeptide 26", cytochrome P450, family 71, subfamily A, polypeptide 26 (.1) AT3G26330 53 / 7e-08 CYP71B37 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G223500 [exp] 78 / 1e-16 AT3G26300 395 / 3e-133 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.012G090000 [exp] 77 / 5e-16 AT3G26330 433 / 5e-148 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) Potri.012G089900 [exp] 73 / 1e-14 AT3G48280 429 / 1e-146 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Potri.015G086000 [exp] 70 / 1e-13 AT1G13080 434 / 2e-148 "cytochrome P450, family 71, subfamily B, polypeptide 2", cytochrome P450, family 71, subfamily B, polypeptide 2 (.1.2) Potri.001G364900 [exp] 69 / 2e-13 AT3G26300 228 / 1e-70 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074300 [exp] 65 / 4e-12 AT3G26300 343 / 6e-113 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.001G365366 [exp] 62 / 3e-11 AT3G26230 228 / 3e-71 "cytochrome P450, family 71, subfamily B, polypeptide 24", cytochrome P450, family 71, subfamily B, polypeptide 24 (.1) Potri.011G130800 [exp] 62 / 4e-11 AT3G26300 359 / 4e-119 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.001G365100 [exp] 62 / 4e-11 AT3G26300 347 / 2e-114 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031674 [exp] 113 / 9e-29 AT3G26300 399 / 3e-134 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Lus10039063 [exp] 107 / 1e-26 AT3G26300 392 / 3e-131 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Lus10012879 [exp] 102 / 1e-24 AT3G26330 409 / 6e-138 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) Lus10038796 [exp] 97 / 4e-23 AT3G26300 364 / 5e-121 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Lus10035706 [exp] 84 / 1e-18 AT3G26300 271 / 5e-86 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Lus10027397 [exp] 81 / 4e-18 AT3G48310 145 / 1e-40 "cytochrome P450, family 71, subfamily A, polypeptide 22", cytochrome P450, family 71, subfamily A, polypeptide 22 (.1) Lus10028926 [exp] 81 / 3e-17 AT3G26330 382 / 3e-127 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) Lus10030924 [exp] 80 / 4e-17 AT3G26300 391 / 2e-131 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Lus10040120 [exp] 77 / 7e-16 AT3G48280 377 / 5e-126 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10016601 [exp] 73 / 9e-15 AT3G26320 402 / 6e-136 "cytochrome P450, family 71, subfamily B, polypeptide 36", cytochrome P450, family 71, subfamily B, polypeptide 36 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.016G007700.2 pacid=42809775 polypeptide=Potri.016G007700.2.p locus=Potri.016G007700 ID=Potri.016G007700.2.v4.1 annot-version=v4.1 ATGATATCACTGACCAAGGAAAGATCACTCTTGGCAGGAGGTTTCAATGTAGTCGATGAACTGTACCCTGCACTAGAGTTTCTTCAAGGAGTTATTGGGA TGAAAGCGGAGAAAGTACTTGCTCAAATAAACCAGATCTTGGATAATATCATTAATGAGCATAAGGAGATGGGAAACAGTGAAACTATAGATGAAGATCC GGTACATATGCTTGTAAGGCTTCAGGAGGATGGAACCTTCAAGTGCCCCATTGAATATTCAACATCAAAGTTAGCCTCTAGGATATGCTCTTTGCAGGTA CTGGAGTTCATAGAATGGGCCATGAAAGAAATCATGAAAAACCCAAGAGTCGTGAAGAAAGCACAGGCTGAGATAAGAGAAGCCCTCAGAGGGAAGAAAA CAATTACAGAGGCTGAGATAAGAGAAGCCCTCAGAGGGAAGAAAACAATTACAGAGGCTGAGATAAGAGAAGCCCTCAGAGGGAAGAAAACAATTACAGA GGCTGAGATAAGAGAAGCCCTTCTTGCATTTTCTAGAAGAAAAGGAAAAAAGATTTTTCAGCCAAGGGTGTTCCTTTTTTTCTTTCATCAGTTCACCAAG ACAAGTCCCTTAATCCTTCATACATGCATGCAGTTTATTCTAAACTTCGATCCCTCGCATTTTTCAACCTTCTTAGCTGGCACATGGCAATAA
AA sequence Show only first row Show all	>Potri.016G007700.2 pacid=42809775 polypeptide=Potri.016G007700.2.p locus=Potri.016G007700 ID=Potri.016G007700.2.v4.1 annot-version=v4.1 MISLTKERSLLAGGFNVVDELYPALEFLQGVIGMKAEKVLAQINQILDNIINEHKEMGNSETIDEDPVHMLVRLQEDGTFKCPIEYSTSKLASRICSLQV LEFIEWAMKEIMKNPRVVKKAQAEIREALRGKKTITEAEIREALRGKKTITEAEIREALRGKKTITEAEIREALLAFSRRKGKKIFQPRVFLFFFHQFTK TSPLILHTCMQFILNFDPSHFSTFLAGTWQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G13310		CYP71A20	"cytochrome P450, family 71, s...		Potri.016G007700 [exp]	0	1
					Potri.015G106750 [exp]	12.00	0.5335
					Potri.008G036350 [exp]	18.00	0.5283
					Potri.001G276104 [exp]	21.93	0.4757
AT3G55260		HEXO1, ATHEX2	beta-hexosaminidase 1 (.1)		Potri.008G049801 [exp]	30.19	0.4514
AT5G18310			unknown protein		Potri.015G040500 [exp]	50.19	0.4340
					Potri.004G208200 [exp]	67.08	0.3527
AT3G04280		ARR22	response regulator 22 (.1.2.3)		Potri.003G172750 [exp]	108.98	0.3194
AT3G28470	MYB	TDF1, ATMYB35	DEFECTIVE IN MERISTEM DEVELOPM...		Potri.012G072500 [exp]	136.99	0.3104	Pt-MYB.54,MYB198

Compare expression of checked genes

Potri.016G007700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.