Potri.016G009200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16447 44 / 3e-06 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G016500 171 / 8e-56 AT4G16447 46 / 5e-07 unknown protein
Potri.001G362000 68 / 2e-15 AT4G16447 50 / 8e-09 unknown protein
Potri.014G165000 67 / 8e-15 AT4G16447 43 / 5e-06 unknown protein
Potri.011G086300 64 / 7e-14 AT4G16447 40 / 6e-05 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012330 49 / 1e-07 ND 40 / 2e-04
Lus10006375 48 / 2e-07 ND 42 / 4e-05
Lus10004411 46 / 5e-07 ND 37 / 9e-04
Lus10032581 44 / 3e-06 ND 40 / 7e-05
Lus10043166 40 / 0.0001 ND 40 / 6e-05
PFAM info
Representative CDS sequence
>Potri.016G009200.1 pacid=42809493 polypeptide=Potri.016G009200.1.p locus=Potri.016G009200 ID=Potri.016G009200.1.v4.1 annot-version=v4.1
ATGGGCAATGAAAATAATGACCCTGTTGTCATTCAATCCTCTATTGCTCTATTGCAAGAGAGATTTAGGCAGTTACAAAGAGTGAAAGCAATGAGAGAGG
AAAAGGAGCTATCAAAAGTTCTTGTGGAGAGTCCTAGGCAATTAAGTCCCTCCATGCAATATGAACCAGCAGCCAGCAGGTTGTTCTTTCACCCTGAATT
GATCCTTCAACCAAGGTCAGTACCGCCCCATATATGCCTCTCTCTTCGGCCAAACCCTCAGAGCAAGCAGGCCGGCTTTTGGTGCGAGCTGGACACCCCA
GCCTTGATGAGTTCGTCTCCAACAAAAACTCTTTCTAGTCATGGCTTATTAGATAAATTTGATGATTCTGCTACTGATGACGATGATATCGATACTTCTC
TTCATTTGTAA
AA sequence
>Potri.016G009200.1 pacid=42809493 polypeptide=Potri.016G009200.1.p locus=Potri.016G009200 ID=Potri.016G009200.1.v4.1 annot-version=v4.1
MGNENNDPVVIQSSIALLQERFRQLQRVKAMREEKELSKVLVESPRQLSPSMQYEPAASRLFFHPELILQPRSVPPHICLSLRPNPQSKQAGFWCELDTP
ALMSSSPTKTLSSHGLLDKFDDSATDDDDIDTSLHL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G16447 unknown protein Potri.016G009200 0 1
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Potri.008G062400 1.00 0.9150
AT1G07670 ATECA4 endomembrane-type CA-ATPase 4 ... Potri.005G147900 1.41 0.9038
AT5G63450 CYP94B1 "cytochrome P450, family 94, s... Potri.002G042200 6.00 0.8711
AT1G60010 unknown protein Potri.008G146500 6.92 0.8752
AT3G15030 TCP TCP4, MEE35 maternal effect embryo arrest ... Potri.011G096600 10.00 0.8325 Pt-TCP1.1
AT1G11340 S-locus lectin protein kinase ... Potri.004G028701 14.07 0.8700
AT4G31500 SUR2, RNT1, RED... SUPERROOT 2, RUNT 1, RED ELONG... Potri.005G236102 15.90 0.8483
AT5G17860 CAX7 calcium exchanger 7 (.1) Potri.013G065800 17.20 0.8727
AT4G28080 Tetratricopeptide repeat (TPR)... Potri.018G102500 17.57 0.8947
AT5G67030 NPQ2, LOS6, IBS... NON-PHOTOCHEMICAL QUENCHING 2,... Potri.005G138400 20.49 0.8504 Pt-ZEAEPOX.2

Potri.016G009200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.