Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RAB11.14
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47520 395 / 7e-142 AtRABA5a RAB GTPase homolog A5A (.1) AT2G31680 278 / 2e-95 AtRABA5d RAB GTPase homolog A5D (.1) AT1G05810 276 / 5e-94 ARA, Ara-1, AtRab11D, AtRABA5e ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) AT2G43130 273 / 1e-93 ARA4, AtRab11F, AtRABA5c, Ara-4 ARABIDOPSIS RAB GTPASE HOMOLOG A5C, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G07410 269 / 5e-92 AtRABA5b RAB GTPase homolog A5B (.1) AT4G39990 263 / 2e-89 ATGB3, AtRABA4b, AtRab11G ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A 4B, GTP-BINDING PROTEIN 3, RAB GTPase homolog A4B (.1) AT5G65270 262 / 5e-89 AtRABA4a RAB GTPase homolog A4A (.1) AT5G47960 258 / 1e-87 SMG1, AtRABA4c SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1) AT1G07410 255 / 1e-86 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT5G59150 249 / 3e-84 ATRAB-A2D, AtRABA2d ARABIDOPSIS RAB GTPASE HOMOLOG A2D, RAB GTPase homolog A2D (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G015400 [exp] 435 / 2e-157 AT5G47520 398 / 5e-143 RAB GTPase homolog A5A (.1) Potri.014G150300 [exp] 286 / 1e-98 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.002G231800 [exp] 285 / 2e-98 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.002G249500 [exp] 269 / 5e-92 AT1G05810 333 / 8e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Potri.007G096000 [exp] 266 / 1e-90 AT5G65270 404 / 2e-145 RAB GTPase homolog A4A (.1) Potri.005G073000 [exp] 262 / 3e-89 AT5G65270 402 / 1e-144 RAB GTPase homolog A4A (.1) Potri.006G000300 [exp] 258 / 9e-88 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.010G197200 [exp] 256 / 5e-87 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.001G270100 [exp] 254 / 3e-86 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038807 [exp] 389 / 3e-139 AT5G47520 376 / 2e-134 RAB GTPase homolog A5A (.1) Lus10000536 [exp] 371 / 3e-132 AT5G47520 369 / 3e-131 RAB GTPase homolog A5A (.1) Lus10017558 [exp] 369 / 2e-131 AT5G47520 367 / 1e-130 RAB GTPase homolog A5A (.1) Lus10026731 [exp] 278 / 1e-95 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10025516 [exp] 278 / 1e-95 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10039051 [exp] 261 / 1e-89 AT5G47520 259 / 2e-89 RAB GTPase homolog A5A (.1) Lus10000637 [exp] 263 / 2e-89 AT5G65270 395 / 8e-142 RAB GTPase homolog A4A (.1) Lus10038226 [exp] 259 / 3e-88 AT1G05810 333 / 3e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Lus10023153 [exp] 259 / 7e-88 AT5G65270 396 / 3e-142 RAB GTPase homolog A4A (.1) Lus10035924 [exp] 259 / 8e-88 AT5G65270 404 / 3e-145 RAB GTPase homolog A4A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.016G010300.2 pacid=42810531 polypeptide=Potri.016G010300.2.p locus=Potri.016G010300 ID=Potri.016G010300.2.v4.1 annot-version=v4.1 ATGGCCTTTTACTCTGAGGATGACAAAGCAGAAGATTACCTTTTCAAGATTGTTTTAATTGGCGACTCAGCTGTTGGGAAATCAAATTTGCTTGCAAGAT TTGCTAGAGATGAATTCTACCCCAATTCAAAGTCTACAATAGGGGTAGAGTTCCAAACCCAAAAGATGGATATTAACGGAAAGGAAATTAAAGCACAGAT CTGGGACACAGCAGGTCAGGAGCGATTTCGGGCTGTAACATCTGCATACTACAGAGGTGCAGTTGGAGCTCTTCTCGTTTATGACATCAGTAGGCGCCAA ACATTTGATAGCGTTGGCAGATGGCTTAACGAACTTCACACTCACTCTGACATGAATGTAGTAACAATACTTGTCGGGAATAAGTCCGATCTCAAGGATG CCAGAGAGGTACCAACAGTGGAAGGCAAGGACTTGGCTGAAGCACAGGGTTTGTTCTTCATGGAAACTTCAGCACTCGATTCCTCCAACGTTGCTGCTGC CTTTCAGACGGTTGTTAAAGAGATCTACAATATATTAAGCCGGAAAGTTATATTATCACAAGAACTCAATAAACCAGGTGCTCCTGAGCTGGGAAACGGA AAGACCGTGGTTTTACAGGGAGATGGGAATCAAGAAGGCAATGCAGAAACTAAAAAAGGGTGCTGTTCATCTTAG
AA sequence Show only first row Show all	>Potri.016G010300.2 pacid=42810531 polypeptide=Potri.016G010300.2.p locus=Potri.016G010300 ID=Potri.016G010300.2.v4.1 annot-version=v4.1 MAFYSEDDKAEDYLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAGQERFRAVTSAYYRGAVGALLVYDISRRQ TFDSVGRWLNELHTHSDMNVVTILVGNKSDLKDAREVPTVEGKDLAEAQGLFFMETSALDSSNVAAAFQTVVKEIYNILSRKVILSQELNKPGAPELGNG KTVVLQGDGNQEGNAETKKGCCSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G47520		AtRABA5a	RAB GTPase homolog A5A (.1)		Potri.016G010300 [exp]	0	1	RAB11.14
AT2G01350		QPT	quinolinate phoshoribosyltrans...		Potri.010G113500 [exp]	12.24	0.7746
AT4G14370			Disease resistance protein (TI...		Potri.011G014501 [exp]	32.63	0.7468
AT2G37678		PAT3, FRY1, FHY...	PHYTOCHROME A SIGNAL TRANSDUCT...		Potri.016G100100 [exp]	42.21	0.7130
AT1G04420			NAD(P)-linked oxidoreductase s...		Potri.015G042100 [exp]	63.21	0.6898
AT1G67080		ABA4	abscisic acid (aba)-deficient ...		Potri.017G114900 [exp]	68.08	0.7106
AT1G67280			Glyoxalase/Bleomycin resistanc...		Potri.006G239802 [exp]	74.93	0.7169
AT1G01020		ARV1	Arv1-like protein (.1.2)		Potri.014G107300 [exp]	164.79	0.6623
AT2G06255		ELF4-L3	ELF4-like 3 (.1)		Potri.019G131700 [exp]	167.36	0.6811
					Potri.019G125100 [exp]	186.82	0.6497
AT4G38160		PDE191	pigment defective 191, Mitocho...		Potri.009G170300 [exp]	187.22	0.6349

Compare expression of checked genes

Potri.016G010300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.