Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20680 231 / 2e-74 MAN2, AtMAN2 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) AT4G28320 222 / 1e-70 MAN5, AtMAN5 endo-beta-mannase 5, Glycosyl hydrolase superfamily protein (.1) AT5G66460 200 / 4e-62 MAN7, AtMAN7 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1) AT5G01930 194 / 1e-59 MAN6, AtMAN6 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1) AT3G10890 178 / 6e-54 Glycosyl hydrolase superfamily protein (.1) AT1G02310 178 / 8e-54 MAN1 endo-beta-mannanase 1, Glycosyl hydrolase superfamily protein (.1) AT3G10900 166 / 4e-49 Glycosyl hydrolase superfamily protein (.1) AT3G30540 153 / 5e-45 Glycosyl hydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G009400 [exp] 365 / 3e-126 AT4G28320 430 / 2e-148 endo-beta-mannase 5, Glycosyl hydrolase superfamily protein (.1) Potri.013G130400 [exp] 232 / 2e-74 AT2G20680 661 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) Potri.005G120500 [exp] 213 / 3e-67 AT5G66460 588 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1) Potri.007G022000 [exp] 201 / 2e-62 AT5G66460 573 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1) Potri.005G229600 [exp] 198 / 1e-61 AT5G66460 542 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1) Potri.016G138600 [exp] 189 / 1e-57 AT5G01930 683 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1) Potri.006G109900 [exp] 187 / 1e-56 AT5G01930 659 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1) Potri.002G184500 [exp] 176 / 3e-53 AT5G66460 447 / 5e-156 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1) Potri.019G070200 [exp] 114 / 6e-30 AT3G10890 302 / 3e-100 Glycosyl hydrolase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039032 [exp] 308 / 5e-104 AT2G20680 433 / 8e-150 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) Lus10027329 [exp] 306 / 3e-103 AT2G20680 438 / 8e-152 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) Lus10033687 [exp] 224 / 2e-71 AT2G20680 644 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) Lus10031650 [exp] 222 / 1e-70 AT2G20680 655 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) Lus10039833 [exp] 221 / 2e-70 AT2G20680 633 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) Lus10018598 [exp] 221 / 2e-70 AT2G20680 627 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1) Lus10014288 [exp] 208 / 4e-65 AT5G66460 583 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1) Lus10014184 [exp] 194 / 2e-59 AT5G01930 674 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1) Lus10030347 [exp] 193 / 4e-59 AT5G66460 422 / 2e-145 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1) Lus10025995 [exp] 197 / 1e-58 AT5G66460 577 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [poplar] [flax] Glyco_hydro_tim PF00150 [poplar] [flax] Cellulase Cellulase (glycosyl hydrolase family 5)
Representative CDS sequence Show only first row Show all	>Potri.016G014801.1 pacid=42809638 polypeptide=Potri.016G014801.1.p locus=Potri.016G014801 ID=Potri.016G014801.1.v4.1 annot-version=v4.1 ATGTCTCTTCATCAGATGACTCATTCTTTTCGAACCCAGTTATTAAAGATTACTTCAAGGCTTATTTATATTAAGGCAGTTGTGAAGAGAAAGAATTCAT TAAGTGGAGTTAGGTACTCTGAAGAACCGGCAATTTTCGCTTGGGAGCTCATGAATGAGCCTCGGTGTTCATCAAGTTCTTCTGCTCCTGCACTTCAGGC ATGGATTGCTGAGATGGCTGCATATATCAAAAGCTTGGATAAAAGACATCTGGTGACTGTTGGACTTGAAGGGTTTTATGGCCTGAATACAACTAACAAG TCAGAAGTGAATCCTGGGATTTGGGCAGCTTCACTTGGATCAGACTTCATACCAAACTCAGCAATATCCAACATCGATTTTGCATCAGTTCACGCATATC CAGACAGCTGGATCCCACATGCTGGTTTGGAAGAGAAAACGAGTTATCTTTCTCATTGGGTGGATTCTCATATAAGTGATGGAGACATTGCGCTGAGGAA ACCAGTTCTTTTCAAAGAAGTCGGCTCAAGTCGGCACGTGGATGAGAAGGGAGTGTTTGACAGAGATGTTTTGTTGAAAACAGTGTATGATAAAATTTAT GAATCCGCAAAGAAGAGGCGGGCTGGTGCCTTTATCTGGCAGTTATTAGTTGAAGGCGTGGATGGATACACTGATAAAACAACAATCATGTAG
AA sequence Show only first row Show all	>Potri.016G014801.1 pacid=42809638 polypeptide=Potri.016G014801.1.p locus=Potri.016G014801 ID=Potri.016G014801.1.v4.1 annot-version=v4.1 MSLHQMTHSFRTQLLKITSRLIYIKAVVKRKNSLSGVRYSEEPAIFAWELMNEPRCSSSSSAPALQAWIAEMAAYIKSLDKRHLVTVGLEGFYGLNTTNK SEVNPGIWAASLGSDFIPNSAISNIDFASVHAYPDSWIPHAGLEEKTSYLSHWVDSHISDGDIALRKPVLFKEVGSSRHVDEKGVFDRDVLLKTVYDKIY ESAKKRRAGAFIWQLLVEGVDGYTDKTTIM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G20680		MAN2, AtMAN2	endo-beta-mannase 2, Glycosyl ...		Potri.016G014801 [exp]	0	1
AT3G49050			alpha/beta-Hydrolases superfam...		Potri.012G142700 [exp]	1.41	0.8021
AT3G21100			RNA-binding (RRM/RBD/RNP motif...		Potri.001G255400 [exp]	8.83	0.7687
AT2G41540		GPDHC1	6-phosphogluconate dehydrogena...		Potri.006G046900 [exp]	16.88	0.7610
AT5G36930			Disease resistance protein (TI...		Potri.005G206400 [exp]	18.97	0.7153
AT1G67400			ELMO/CED-12 family protein (.1...		Potri.010G060700 [exp]	23.95	0.7321
AT5G23280	TCP	TCP7	TCP family transcription facto...		Potri.007G074028 [exp]	26.55	0.7482
AT5G56040			Leucine-rich receptor-like pro...		Potri.011G164800 [exp]	31.55	0.7547
AT1G78940			Protein kinase protein with ad...		Potri.007G001900 [exp]	31.63	0.7182
AT3G19850			Phototropic-responsive NPH3 fa...		Potri.008G085500 [exp]	41.13	0.7288
AT4G13730			Ypt/Rab-GAP domain of gyp1p su...		Potri.006G069300 [exp]	42.07	0.7268

Compare expression of checked genes

Potri.016G014801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.