Potri.016G015500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22142 152 / 9e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT3G22120 134 / 1e-35 CWLP cell wall-plasma membrane linker protein (.1)
AT4G15160 128 / 1e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT1G62500 125 / 8e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G10940 110 / 3e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT4G12470 88 / 2e-20 AZI1 azelaic acid induced 1 (.1)
AT2G45180 87 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12480 87 / 8e-20 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12490 87 / 9e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12500 86 / 2e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G008500 152 / 4e-44 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1)
Potri.006G008300 151 / 4e-43 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.003G111300 122 / 6e-32 AT1G62500 125 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G065500 119 / 2e-31 AT2G10940 147 / 8e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.018G126000 116 / 6e-29 AT2G10940 109 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.018G025900 94 / 4e-23 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G121900 91 / 2e-21 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G158400 86 / 7e-20 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.003G111400 85 / 1e-19 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010482 140 / 2e-40 AT3G22142 162 / 5e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10003801 137 / 4e-37 AT3G22142 168 / 7e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032262 127 / 2e-33 AT1G62500 162 / 3e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10028930 124 / 5e-33 AT1G62500 141 / 4e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10010479 120 / 3e-31 AT3G22142 168 / 3e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10004349 114 / 3e-29 AT1G62500 134 / 5e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10027704 102 / 3e-25 AT2G10940 135 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10003802 101 / 4e-24 ND 127 / 5e-33
Lus10001493 92 / 2e-22 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032263 87 / 4e-20 AT4G12520 135 / 9e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF14547 Hydrophob_seed Hydrophobic seed protein
Representative CDS sequence
>Potri.016G015500.1 pacid=42810577 polypeptide=Potri.016G015500.1.p locus=Potri.016G015500 ID=Potri.016G015500.1.v4.1 annot-version=v4.1
ATGGCCAAGTTTGCTCTGGCTAACCTCTTGATCCTCCTTGTGAACTTGGGCACTTTGCTCACGTCACTTGCTTGTCCCTATTGCCCTTACCCAGCTCCGC
CATCTAAACCACCACAGTATCCTCCAAAGATACCACCGGTGCATCCTCCTCCCAAAGTAAAGCCACCACCAAAGTATCCTCCAAAGATACCACCGGTGCA
TCCTCCTCCCAAAGTAAAGCCGCCACCAAAGTATCCTCCTAAGATACCACCGGTGCACCCTCCTCCCAAAGTAAAGCCACCATCAAAGTATCCTCCTAAG
ATACCACCGGTGCACCCTCCTCCCAAAGTAAAGCCACCACCAAAGTGTCCTCCTAAGATACCACCGGTGCATCCTCCTCCCACAGTAAAGCCACCCCATG
ACCCTAAACCCCCCAAACCCCACCCACCTAAGCCGCCTGTTGTTCCCAAACCTCCCATTGTACATCCCCCGTTTAAACCGAAACCACCCATTGTGCATCC
GCCCTATACACCGAAACCACCCATTGTGCATCCGCCCTTCAAACCGAAACCACCCATTGTGCATCCGCCCTTCAAACCGAAACCACCCATTGTGCATCCG
CCCTTCATACCAAAACCACCATATGTGCCCAAACCACCAGTTCTGCCACCAACACCACCAGCTCTTCCACCACCAAAGCCTCCAGTGATTCCTCCAATAA
AGCCACCAACACCTCCAGCTCTTCCACCACCAACTCTTCCACCACCAAAGCCTCCAGTGACTCCTCCAATAAAGCCACCAACACCACCAACTCTTCCACC
ACCAAAGCCTCCAGTGACTCCTCCAATAATGCCACCAACACCACCAACTCTTCCACCACCAAAGCCTCCAGTGACTCCTCCAATAATGCCACCAACACCA
CCAACACCACCAACTCTTCCACCACCAAAGCCTCCAGTGACTCCTCCAATAATGCCACCAGCACCACCAACTCTTCCACCACCAAAGCCTCCAGTGACTC
CTCCAATAAAGCCACCAACACCACCTATTGTGAACCCTCCACCACCTGAAACACCATGTCCTCCACCTCCACCACCACCACCAAAACAAGAGACTTGCTC
CATTGACACTCTCAAGCTAGGTGCATGTGTGGATGTGTTAGGTGGACTGGTCCACATTGGTATTGGCAGTAGTGCCAAGGATGCATGCTGTCCAGTGCTT
CAAGGTCTTCTTGACTTGGATGCTGCCATATGTCTTTGCACCACCATTAAGGCTAAGCTTCTCAACATCAGTATCATTATACCCATTGCTCTTGAGGTCC
TTGTTGACTGTGGCAAGACCCCACCTGAAGGGTTCAAGTGCCCTGCTTAA
AA sequence
>Potri.016G015500.1 pacid=42810577 polypeptide=Potri.016G015500.1.p locus=Potri.016G015500 ID=Potri.016G015500.1.v4.1 annot-version=v4.1
MAKFALANLLILLVNLGTLLTSLACPYCPYPAPPSKPPQYPPKIPPVHPPPKVKPPPKYPPKIPPVHPPPKVKPPPKYPPKIPPVHPPPKVKPPSKYPPK
IPPVHPPPKVKPPPKCPPKIPPVHPPPTVKPPHDPKPPKPHPPKPPVVPKPPIVHPPFKPKPPIVHPPYTPKPPIVHPPFKPKPPIVHPPFKPKPPIVHP
PFIPKPPYVPKPPVLPPTPPALPPPKPPVIPPIKPPTPPALPPPTLPPPKPPVTPPIKPPTPPTLPPPKPPVTPPIMPPTPPTLPPPKPPVTPPIMPPTP
PTPPTLPPPKPPVTPPIMPPAPPTLPPPKPPVTPPIKPPTPPIVNPPPPETPCPPPPPPPPKQETCSIDTLKLGACVDVLGGLVHIGIGSSAKDACCPVL
QGLLDLDAAICLCTTIKAKLLNISIIIPIALEVLVDCGKTPPEGFKCPA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G22142 Bifunctional inhibitor/lipid-t... Potri.016G015500 0 1
AT1G68150 WRKY ATWRKY9, WRKY9 WRKY DNA-binding protein 9 (.1... Potri.001G208600 10.04 0.8850 Pt-WRKY9.1
AT5G06270 unknown protein Potri.006G206000 12.40 0.8486
AT1G70230 AXY4, TBL27 ALTERED XYLOGLUCAN 4, TRICHOME... Potri.010G095700 17.97 0.8384
AT2G15490 UGT73B4 UDP-glycosyltransferase 73B4 (... Potri.006G272600 18.81 0.8743
Potri.001G019890 33.46 0.8576
AT3G47780 ABCA7, ATATH6 A. THALIANA ABC2 HOMOLOG 6, AT... Potri.015G063400 39.86 0.8543 Pt-ATH2.2
AT5G06710 HD HAT14 homeobox from Arabidopsis thal... Potri.018G133100 47.49 0.7894
AT3G10300 Calcium-binding EF-hand family... Potri.006G047300 47.74 0.8503
AT2G46495 RING/U-box superfamily protein... Potri.002G170300 56.28 0.8435
AT2G03360 Glycosyltransferase family 61 ... Potri.010G162100 57.18 0.8439

Potri.016G015500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.