Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPL27.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15000 209 / 4e-71 Ribosomal L27e protein family (.1.2) AT3G22230 206 / 5e-70 Ribosomal L27e protein family (.1) AT2G32220 196 / 4e-66 Ribosomal L27e protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G342500 [exp] 225 / 3e-77 AT4G15000 210 / 2e-71 Ribosomal L27e protein family (.1.2) Potri.006G021500 [exp] 224 / 4e-77 AT4G15000 205 / 2e-69 Ribosomal L27e protein family (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039017 [exp] 214 / 9e-73 AT4G15000 232 / 3e-80 Ribosomal L27e protein family (.1.2) Lus10027314 [exp] 211 / 8e-72 AT4G15000 233 / 2e-80 Ribosomal L27e protein family (.1.2) Lus10003814 [exp] 211 / 1e-71 AT4G15000 239 / 7e-83 Ribosomal L27e protein family (.1.2) Lus10010461 [exp] 209 / 9e-71 AT4G15000 236 / 7e-82 Ribosomal L27e protein family (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01777 [poplar] [flax] Ribosomal_L27e Ribosomal L27e protein family
Representative CDS sequence Show only first row Show all	>Potri.016G019000.1 pacid=42809204 polypeptide=Potri.016G019000.1.p locus=Potri.016G019000 ID=Potri.016G019000.1.v4.1 annot-version=v4.1 ATGGTGAAGTTTCTCAAGCCCAACAAGGCCGTCATAATCCTCCAAGGCCGCTATGCAGGTCGCAAAGCAGTGATCGTGAAGCACTTCGATGACGGAACAA GAGACCGTCCATATGGGCACTGTTTAGTGGCAGGAATCAAGAAGTACCCAAGCAAGGTTATAAAGAAAGATTCTACCAAGAAAACAGCCAAGAAATCGAG GGTCAAGTGTTTTATCAAGCTTGTTAACTACCAACATCTGATGCCGACAAGGTATACATTGGATGTAGATTTGAAGGATGCTGTCACTGCAGATAGTTTG ACTACTAAGGATAAGAAAGTTACTGCTTGCAAGGATACAAAGGCAAGGTTCGAGGAGCGTTTTAAGACTGGAAAGAACCGTTGGTTTTTTACCAAGCTGA GGTTTTGA
AA sequence Show only first row Show all	>Potri.016G019000.1 pacid=42809204 polypeptide=Potri.016G019000.1.p locus=Potri.016G019000 ID=Potri.016G019000.1.v4.1 annot-version=v4.1 MVKFLKPNKAVIILQGRYAGRKAVIVKHFDDGTRDRPYGHCLVAGIKKYPSKVIKKDSTKKTAKKSRVKCFIKLVNYQHLMPTRYTLDVDLKDAVTADSL TTKDKKVTACKDTKARFEERFKTGKNRWFFTKLRF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G15000			Ribosomal L27e protein family ...		Potri.016G019000 [exp]	0	1	RPL27.1
AT2G19740			Ribosomal protein L31e family ...		Potri.018G070100 [exp]	1.41	0.9610
AT3G05560			Ribosomal L22e protein family ...		Potri.014G128800 [exp]	3.16	0.9559	RPL22.2
AT5G61170			Ribosomal protein S19e family ...		Potri.004G118800 [exp]	3.46	0.9554	RPS19.1
AT4G14320			Zinc-binding ribosomal protein...		Potri.007G071800 [exp]	8.36	0.9500
AT4G27090			Ribosomal protein L14 (.1)		Potri.010G069900 [exp]	8.66	0.9399
AT2G09990			Ribosomal protein S5 domain 2-...		Potri.010G091000 [exp]	9.74	0.9319
AT4G10450			Ribosomal protein L6 family (....		Potri.011G147700 [exp]	10.09	0.9498	Pt-RPL9.4
AT5G48760			Ribosomal protein L13 family p...		Potri.017G054600 [exp]	10.19	0.9444	RPL13.2
AT1G70600			Ribosomal protein L18e/L15 sup...		Potri.006G202300 [exp]	10.58	0.9488	Pt-RPL27.4
AT1G26880			Ribosomal protein L34e superfa...		Potri.015G106532 [exp]	11.48	0.9282

Compare expression of checked genes

Potri.016G019000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.