Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G021600 [exp] 55 / 8e-12 AT1G05340 / unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039015 [exp] 37 / 0.0001 AT2G32190 76 / 3e-20 unknown protein Lus10010460 [exp] 35 / 0.0006 AT2G32190 79 / 3e-21 unknown protein Lus10003815 [exp] 35 / 0.001 AT2G32210 79 / 3e-21 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12734 [poplar] [flax] CYSTM Cysteine-rich TM module stress tolerance
Representative CDS sequence Show only first row Show all	>Potri.016G019201.1 pacid=42810062 polypeptide=Potri.016G019201.1.p locus=Potri.016G019201 ID=Potri.016G019201.1.v4.1 annot-version=v4.1 ATGAGTCAGAATCAGGCTACAGTGGCATATCCTCCTCCACCAGCATCAACTGGTCCTAGTGCATATTCAGCCCCTCCACCAGCTGGCTATCCAACCATGG ATGGCCAAACCTGCCAGCAAGATCCTATTCCTGTGGAGACCAAATCCAGGGGTGATGGCTTCTGGAAAGGATGTTGTGCTGCCTTGTGTTGTTGTTGTGC CTTGGACGCTTGCTTCTGA
AA sequence Show only first row Show all	>Potri.016G019201.1 pacid=42810062 polypeptide=Potri.016G019201.1.p locus=Potri.016G019201 ID=Potri.016G019201.1.v4.1 annot-version=v4.1 MSQNQATVAYPPPPASTGPSAYSAPPPAGYPTMDGQTCQQDPIPVETKSRGDGFWKGCCAALCCCCALDACF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G05340			unknown protein		Potri.016G019201 [exp]	0	1
AT1G07570		APK1A	Protein kinase superfamily pro...		Potri.008G056400 [exp]	2.23	0.9231
AT2G38470	WRKY	ATWRKY33, WRKY3...	WRKY DNA-binding protein 33 (....		Potri.019G123500 [exp]	6.63	0.8994
AT5G41350			RING/U-box superfamily protein...		Potri.003G129900 [exp]	6.70	0.8931
AT1G69640		SBH1	sphingoid base hydroxylase 1 (...		Potri.002G061400 [exp]	7.34	0.8991
AT4G18880	HSF	AT-HSFA4A ,HSF ...	ARABIDOPSIS THALIANA HEAT SHOC...		Potri.014G141400 [exp]	9.48	0.8868
AT5G41610		ATCHX18	cation/H+ exchanger 18, ARABID...		Potri.003G134900 [exp]	9.79	0.8956
AT5G19080			RING/U-box superfamily protein...		Potri.013G025400 [exp]	11.83	0.8923
AT4G09760			Protein kinase superfamily pro...		Potri.005G197500 [exp]	12.72	0.8833
AT1G28380		NSL1	necrotic spotted lesions 1, MA...		Potri.004G047700 [exp]	13.78	0.8955
AT5G48655			RING/U-box superfamily protein...		Potri.003G148300 [exp]	16.24	0.8896

Compare expression of checked genes

Potri.016G019201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.