Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78270 123 / 1e-34 ATUGT85A4 UDP-glucosyl transferase 85A4 (.1) AT1G22360 114 / 3e-31 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2) AT1G22370 113 / 4e-31 ATUGT85A5 UDP-glucosyl transferase 85A5 (.1.2) AT1G22340 112 / 2e-30 ATUGT85A7 UDP-glucosyl transferase 85A7 (.1) AT1G22380 112 / 2e-30 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1) AT1G22400 109 / 1e-29 ATUGT85A1, UGT85A1 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) AT3G02100 63 / 6e-13 UDP-Glycosyltransferase superfamily protein (.1) AT5G38010 59 / 1e-11 UDP-Glycosyltransferase superfamily protein (.1) AT3G46660 59 / 1e-11 UGT76E12 UDP-glucosyl transferase 76E12 (.1) AT3G46670 56 / 2e-10 UGT76E11 UDP-glucosyl transferase 76E11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G021600 [exp] 137 / 4e-40 AT1G22370 473 / 2e-165 UDP-glucosyl transferase 85A5 (.1.2) Potri.016G021100 [exp] 137 / 9e-40 AT1G22360 505 / 5e-177 UDP-glucosyl transferase 85A2 (.1.2) Potri.006G023101 [exp] 133 / 2e-38 AT1G22360 516 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.006G022300 [exp] 132 / 5e-38 AT1G22360 518 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.006G022500 [exp] 131 / 9e-38 AT1G22400 514 / 3e-180 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.006G022600 [exp] 131 / 1e-37 AT1G22400 515 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.016G021300 [exp] 131 / 1e-37 AT1G22400 522 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.016G020800 [exp] 130 / 1e-37 AT1G22340 446 / 1e-154 UDP-glucosyl transferase 85A7 (.1) Potri.006G022800 [exp] 130 / 2e-37 AT1G22400 470 / 1e-163 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013652 [exp] 115 / 5e-32 AT1G22360 359 / 3e-121 UDP-glucosyl transferase 85A2 (.1.2) Lus10035903 [exp] 115 / 1e-31 AT1G22360 522 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Lus10010665 [exp] 113 / 8e-31 AT1G22400 516 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10007421 [exp] 109 / 1e-29 AT1G22400 529 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10019364 [exp] 109 / 1e-29 AT1G22400 523 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10024584 [exp] 109 / 2e-29 AT1G22400 570 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10024583 [exp] 105 / 3e-28 AT1G22380 598 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10032220 [exp] 105 / 5e-28 AT1G22380 601 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10017542 [exp] 105 / 6e-28 AT1G22400 499 / 4e-174 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10025741 [exp] 105 / 7e-28 AT1G22380 525 / 0.0 UDP-glucosyl transferase 85A3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.016G020201.1 pacid=42809149 polypeptide=Potri.016G020201.1.p locus=Potri.016G020201 ID=Potri.016G020201.1.v4.1 annot-version=v4.1 ATGGCTGATAAGCCCCATGCAGTTCTTATCCCACTTCCATTTCAAAGCCATATAAAATCTATGCTAAAACTAGCCAAACTACTTCATCACAGAGGTTTTC ACATAACCTTTGTCAATACTGAATATAACCATAGACGCTTACTTAAATCTAGAGGTCCTAATTCCCTCAACGGTTTGCTTGATTTTCGATTTGAAAACAT TCCAGATGGGCTCCCTCATTCGGATATTGATGCTTCAATTCCCAAGATATCCTTGCACTTTTTGAGGCTGTCAAGAACAACTTAA
AA sequence Show only first row Show all	>Potri.016G020201.1 pacid=42809149 polypeptide=Potri.016G020201.1.p locus=Potri.016G020201 ID=Potri.016G020201.1.v4.1 annot-version=v4.1 MADKPHAVLIPLPFQSHIKSMLKLAKLLHHRGFHITFVNTEYNHRRLLKSRGPNSLNGLLDFRFENIPDGLPHSDIDASIPKISLHFLRLSRTT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G78270		ATUGT85A4	UDP-glucosyl transferase 85A4 ...		Potri.016G020201 [exp]	0	1
AT5G10250		DOT3	DEFECTIVELY ORGANIZED TRIBUTAR...		Potri.005G075400 [exp]	1.00	0.9845
AT2G45190	YABBY	FIL, YAB1, AFO	YABBY1, FILAMENTOUS FLOWER, AB...		Potri.002G145100 [exp]	3.16	0.9799
AT1G02205		CER1	ECERIFERUM 1, Fatty acid hydro...		Potri.014G152600 [exp]	6.32	0.9686
AT1G67090		RBCS1A	ribulose bisphosphate carboxyl...		Potri.017G114600 [exp]	8.48	0.9685
AT1G02205		CER1	ECERIFERUM 1, Fatty acid hydro...		Potri.014G152301 [exp]	9.38	0.9606
AT5G64040		PSAN, PSI-N	photosystem I reaction center ...		Potri.005G063300 [exp]	9.38	0.9697
AT2G24270		ALDH11A3	aldehyde dehydrogenase 11A3 (....		Potri.018G109700 [exp]	10.24	0.9658	Pt-ALDH11.1
AT1G60600		ABC4	ABERRANT CHLOROPLAST DEVELOPME...		Potri.001G311400 [exp]	10.95	0.9460
AT5G04590		SIR	sulfite reductase (.1)		Potri.009G052600 [exp]	11.31	0.9651
AT3G63410		VTE3, APG1, IEP...	VITAMIN E DEFECTIVE 3, INNER E...		Potri.008G159400 [exp]	12.00	0.9618	Pt-APG1.1

Compare expression of checked genes

Potri.016G020201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.