Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22360 189 / 5e-58 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2) AT1G22370 186 / 6e-57 ATUGT85A5 UDP-glucosyl transferase 85A5 (.1.2) AT1G22380 185 / 1e-56 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1) AT1G22400 181 / 5e-55 ATUGT85A1, UGT85A1 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) AT1G22340 180 / 2e-54 ATUGT85A7 UDP-glucosyl transferase 85A7 (.1) AT1G78270 177 / 1e-53 ATUGT85A4 UDP-glucosyl transferase 85A4 (.1) AT3G11340 86 / 9e-20 UGT76B1 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) AT3G46670 83 / 9e-19 UGT76E11 UDP-glucosyl transferase 76E11 (.1) AT3G46660 82 / 3e-18 UGT76E12 UDP-glucosyl transferase 76E12 (.1) AT3G46650 81 / 6e-18 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G022100 [exp] 350 / 8e-121 AT1G22380 489 / 2e-170 UDP-glucosyl transferase 85A3 (.1) Potri.016G021500 [exp] 342 / 1e-117 AT1G22360 501 / 3e-175 UDP-glucosyl transferase 85A2 (.1.2) Potri.016G022400 [exp] 335 / 6e-115 AT1G22360 495 / 4e-173 UDP-glucosyl transferase 85A2 (.1.2) Potri.016G022000 [exp] 335 / 7e-115 AT1G22360 499 / 1e-174 UDP-glucosyl transferase 85A2 (.1.2) Potri.007G132400 [exp] 290 / 2e-97 AT1G22340 527 / 0.0 UDP-glucosyl transferase 85A7 (.1) Potri.006G023600 [exp] 247 / 2e-80 AT1G22380 526 / 0.0 UDP-glucosyl transferase 85A3 (.1) Potri.016G021000 [exp] 227 / 2e-72 AT1G22360 561 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.016G020500 [exp] 224 / 9e-72 AT1G22380 527 / 0.0 UDP-glucosyl transferase 85A3 (.1) Potri.016G020900 [exp] 223 / 3e-71 AT1G22380 538 / 0.0 UDP-glucosyl transferase 85A3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013652 [exp] 188 / 2e-58 AT1G22360 359 / 3e-121 UDP-glucosyl transferase 85A2 (.1.2) Lus10024584 [exp] 189 / 7e-58 AT1G22400 570 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10032220 [exp] 187 / 2e-57 AT1G22380 601 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10019364 [exp] 187 / 5e-57 AT1G22400 523 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10024583 [exp] 186 / 1e-56 AT1G22380 598 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10007421 [exp] 186 / 2e-56 AT1G22400 529 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10010665 [exp] 184 / 3e-56 AT1G22400 516 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10031388 [exp] 179 / 3e-54 AT1G22400 644 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10041055 [exp] 178 / 9e-54 AT1G22360 610 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Lus10017542 [exp] 176 / 1e-52 AT1G22400 499 / 4e-174 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.016G022250.1 pacid=42809615 polypeptide=Potri.016G022250.1.p locus=Potri.016G022250 ID=Potri.016G022250.1.v4.1 annot-version=v4.1 ATGGGATCCATTTCGAAGCCTCATGTTGTTGTGATCCCATGTCCACTCCAAGGTCATATAAAGACTATGCTTAAACTTGCGAAGCTTCTTCACTACAAAG GTCTTCACATCACGTTTGTCAGCACAGAATTCAATCACAAACGCTTCCTTAGGTCAAGAGGACCTCATGCTCTTGATGACTTGCCTGGCTTCCATTTTAG AACCATTCCTGATGGTCTCCCTCCTTCAGATATTGATGCCACCCAAGACATTCCTTCTCTTTGTGATGCCATGAACAAGAATTTCTTAGCACCCTTTAAA GATCTTCTTTTGGAACTCAGAAATACCGTATCGGAGAACAACCCTCCGGTTACCTGCATTGTTTCTGATCCCTTCGCTCCAATCTCCATCAAAGCTGGGG AAGAAGTTGGTCTTCCAGTTGTGATGTATGCCACTATGAATGCATGTGGCTATATGGGATTTAAACAGCTCCATGCTCTCAGAGAGAGAGGCTTCACCCC AATCAAAGATTCTCCCTTGCAAGTTGATGGAGAAATGATTATAAAACATTATCACGACAACAATTTCTTTTATTTATAA
AA sequence Show only first row Show all	>Potri.016G022250.1 pacid=42809615 polypeptide=Potri.016G022250.1.p locus=Potri.016G022250 ID=Potri.016G022250.1.v4.1 annot-version=v4.1 MGSISKPHVVVIPCPLQGHIKTMLKLAKLLHYKGLHITFVSTEFNHKRFLRSRGPHALDDLPGFHFRTIPDGLPPSDIDATQDIPSLCDAMNKNFLAPFK DLLLELRNTVSENNPPVTCIVSDPFAPISIKAGEEVGLPVVMYATMNACGYMGFKQLHALRERGFTPIKDSPLQVDGEMIIKHYHDNNFFYL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Potri.016G022250 [exp]	0	1
AT2G44930			Plant protein of unknown funct...		Potri.014G054100 [exp]	2.00	0.8897
AT5G40990		GLIP1	GDSL lipase 1 (.1)		Potri.017G136601 [exp]	23.83	0.8319
					Potri.019G017150 [exp]	30.06	0.8372
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Potri.010G247200 [exp]	32.83	0.8411
					Potri.012G106675 [exp]	38.06	0.8217
AT5G27550			P-loop containing nucleoside t...		Potri.005G031801 [exp]	40.29	0.8531
AT5G27550			P-loop containing nucleoside t...		Potri.005G030271 [exp]	43.01	0.8794
AT1G21740			Protein of unknown function (D...		Potri.004G177200 [exp]	44.89	0.8447
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Potri.016G120466 [exp]	47.01	0.8514
AT3G01930			Major facilitator superfamily ...		Potri.001G329100 [exp]	48.42	0.8508

Compare expression of checked genes

Potri.016G022250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.