Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-SIP2.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56950 303 / 1e-104 SIP2;1, SIP2 small and basic intrinsic protein 2;1 (.1.2) AT5G18290 91 / 9e-22 SIP1B, SIP1;2 SMALL AND BASIC INTRINSIC PROTEIN 1B, Aquaporin-like superfamily protein (.1.2) AT3G04090 86 / 4e-20 SIP1A, SIP1;1 small and basic intrinsic protein 1A (.1) AT5G47450 46 / 6e-06 ATTIP2;3, DELTA-TIP3 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) AT4G17340 44 / 5e-05 TIP2;2, DELTA-TIP2 tonoplast intrinsic protein 2;2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G027200 [exp] 422 / 7e-152 AT3G56950 264 / 1e-89 small and basic intrinsic protein 2;1 (.1.2) Potri.013G053400 [exp] 125 / 5e-35 AT3G04090 224 / 6e-74 small and basic intrinsic protein 1A (.1) Potri.019G030900 [exp] 111 / 7e-30 AT3G04090 236 / 3e-78 small and basic intrinsic protein 1A (.1) Potri.014G154400 [exp] 108 / 8e-29 AT5G18290 183 / 2e-57 SMALL AND BASIC INTRINSIC PROTEIN 1B, Aquaporin-like superfamily protein (.1.2) Potri.002G227500 [exp] 107 / 5e-28 AT5G18290 165 / 2e-50 SMALL AND BASIC INTRINSIC PROTEIN 1B, Aquaporin-like superfamily protein (.1.2) Potri.001G157000 [exp] 42 / 0.0002 AT4G17340 333 / 3e-116 tonoplast intrinsic protein 2;2 (.1) Potri.003G077800 [exp] 41 / 0.0005 AT4G17340 351 / 2e-123 tonoplast intrinsic protein 2;2 (.1) Potri.017G083300 [exp] 40 / 0.0007 AT4G18910 229 / 2e-74 NOD26-LIKE INTRINSIC PROTEIN 2, NOD26-like intrinsic protein 1;2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035395 [exp] 337 / 2e-112 AT5G05070 463 / 1e-158 DHHC-type zinc finger family protein (.1) Lus10030997 [exp] 311 / 1e-102 AT3G56930 332 / 1e-107 DHHC-type zinc finger family protein (.1.2) Lus10027275 [exp] 296 / 3e-102 AT3G56950 249 / 2e-83 small and basic intrinsic protein 2;1 (.1.2) Lus10038989 [exp] 293 / 9e-101 AT3G56950 248 / 5e-83 small and basic intrinsic protein 2;1 (.1.2) Lus10035281 [exp] 97 / 3e-24 AT3G04090 176 / 9e-55 small and basic intrinsic protein 1A (.1) Lus10030046 [exp] 94 / 8e-23 AT3G04090 172 / 2e-53 small and basic intrinsic protein 1A (.1) Lus10021989 [exp] 63 / 4e-11 AT5G65560 498 / 2e-157 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10042528 [exp] 0 / 1 AT5G18280 684 / 0.0 apyrase 2 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00230 [poplar] [flax] MIP Major intrinsic protein
Representative CDS sequence Show only first row Show all	>Potri.016G024900.3 pacid=42809242 polypeptide=Potri.016G024900.3.p locus=Potri.016G024900 ID=Potri.016G024900.3.v4.1 annot-version=v4.1 ATGGTTTCCAAGACTCGTTTAATTCTGTCAGATTTTGTAGTTTCTCTTATGTGGGTATGGTCAGGTTCTTTGATAAAGATTTTTGTGTTCAAGGTTTTGG GAATGGGGCATGATTCAAGAGGTGAATTTTTGAAGAATTCTTTGTCAATTATGAACATGTTTCTTTTTGCGTTCTTGGGTAAGGTTACTAAAGGAGGGGC TTATAATCCTCTTACTATTTTGTCTTCTGCTATTTCTGGGGATTTCAGTCAGTTTCTCTTCACCATTGGGGCTAGAATCCCTGCTCAGGTAATTGGATCT ATCACTGGGGTTAGGCTCTTTATTGATACGTTTCCTGAGATAGGACTTGGACCACGTTTGACTGTTGACATCCATAAAGGAGCTCTCACAGAAGGATTGC TGACATTTGCCATTGTTACTATCTCTCTTGGGCTTGCAAGAAAGATCCCTGGAAGTTTCTTCATGAAGACTTGGATCTCAAGTGTCTCGAAGTTATCTCT TCACATACTTGGCTCTGATCTAACGGGTGGTTGTATGAACCCAGCCTCTGTGATGGGATGGGCTTATGCCCGTGGAGATCATATAACCAAGGAGCATATA CTCGTATATTGGCTTGCCCCAATAGAGGGAACTCTGCTGGCAGTATGGACATTTAAGTTGCTATTTCGTCCACAAAAACAAGATGAGAAAGAAAAGTTGA AGGGCAAAACAGAATGA
AA sequence Show only first row Show all	>Potri.016G024900.3 pacid=42809242 polypeptide=Potri.016G024900.3.p locus=Potri.016G024900 ID=Potri.016G024900.3.v4.1 annot-version=v4.1 MVSKTRLILSDFVVSLMWVWSGSLIKIFVFKVLGMGHDSRGEFLKNSLSIMNMFLFAFLGKVTKGGAYNPLTILSSAISGDFSQFLFTIGARIPAQVIGS ITGVRLFIDTFPEIGLGPRLTVDIHKGALTEGLLTFAIVTISLGLARKIPGSFFMKTWISSVSKLSLHILGSDLTGGCMNPASVMGWAYARGDHITKEHI LVYWLAPIEGTLLAVWTFKLLFRPQKQDEKEKLKGKTE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G56950		SIP2;1, SIP2	small and basic intrinsic prot...		Potri.016G024900 [exp]	0	1	Pt-SIP2.1
AT3G02580		BUL1, DWF7, STE...	DWARF 7, BOULE 1, sterol 1 (.1...		Potri.017G116600 [exp]	1.00	0.7663	DWF7.3
AT3G21510		ATHP3, AHP1	histidine-containing phosphotr...		Potri.010G027100 [exp]	6.70	0.7357	AHP1.1
AT3G17240		mtLPD2, LPD2	lipoamide dehydrogenase 2 (.1....		Potri.008G100800 [exp]	14.49	0.7398	LPD1,Pt-LPD.1
AT1G19920		ASA1, APS2	ATP SULFURYLASE ARABIDOPSIS 1,...		Potri.002G024200 [exp]	36.74	0.6844
AT5G63060			Sec14p-like phosphatidylinosit...		Potri.015G080100 [exp]	159.04	0.6287
AT4G07940			Protein of unknown function (D...		Potri.006G202400 [exp]	184.67	0.6374
AT4G25030			unknown protein		Potri.008G042100 [exp]	217.08	0.6364

Compare expression of checked genes

Potri.016G024900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.