Potri.016G027201 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G42170 61 / 8e-11 BED zinc finger ;hAT family dimerisation domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G026066 332 / 2e-112 AT3G42170 0 / 1 BED zinc finger ;hAT family dimerisation domain (.1)
Potri.017G019466 183 / 9e-54 AT3G42170 279 / 6e-82 BED zinc finger ;hAT family dimerisation domain (.1)
Potri.011G104000 102 / 3e-25 AT3G42170 381 / 7e-123 BED zinc finger ;hAT family dimerisation domain (.1)
Potri.001G383800 93 / 4e-22 AT3G42170 387 / 4e-125 BED zinc finger ;hAT family dimerisation domain (.1)
Potri.003G031700 91 / 4e-21 AT3G42170 581 / 0.0 BED zinc finger ;hAT family dimerisation domain (.1)
Potri.018G126750 81 / 7e-18 AT3G42170 857 / 0.0 BED zinc finger ;hAT family dimerisation domain (.1)
Potri.018G126500 74 / 2e-15 AT3G42170 796 / 0.0 BED zinc finger ;hAT family dimerisation domain (.1)
Potri.011G125951 72 / 1e-14 AT3G42170 313 / 2e-95 BED zinc finger ;hAT family dimerisation domain (.1)
Potri.004G126740 70 / 6e-14 AT3G42170 803 / 0.0 BED zinc finger ;hAT family dimerisation domain (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005558 92 / 1e-21 AT3G42170 351 / 5e-111 BED zinc finger ;hAT family dimerisation domain (.1)
Lus10032337 72 / 2e-14 AT3G42170 839 / 0.0 BED zinc finger ;hAT family dimerisation domain (.1)
PFAM info
Representative CDS sequence
>Potri.016G027201.1 pacid=42810293 polypeptide=Potri.016G027201.1.p locus=Potri.016G027201 ID=Potri.016G027201.1.v4.1 annot-version=v4.1
ATGATGATTAAGCATGGATATCCCTTGGCTATGGTTCAACATGAGTTTTTTGAAATTTTTGTGAAGAATTTGCAGCCGGTGTTTAAACTTTATTCAAAAG
ACGTAGTTGAAGCTGATGTCCTTGCTATTTGCAGACAAGAGAAGGAGAAACTCATCAGTTTTTTTGATAATCTCTCTTGTCTCTTGAGTTTAACACTTGA
ATTGCGGTCATCTAATGACAAAATGATGAACTACTGTTGCTTCACTGTGCACTTCATTGACGATGGATGGCAGCTGAAGAAGAAGATTCTTGCTTTCAGG
AACTTACGGTACAACTATGACATGGGGACTGTACATAAAGTCTTTAATAGTGTGCTTACAGAGTGGAGCATCAACAAGAACGTTCGCTTCATATTCCTGG
ATGTAACTCCTCCAAAGGATCACACGATTGGAGAATTAAGAAGTAAGGTTTCTGATCAAGCCCCACCAATCCATAGACATCTTTTCTGTGTTCCTAGTTA
TGCCCAAATTCTCAGTCTCCTTGCTCAAGATGGATTTTCTGAGATAAGGAGTGTGCTTTATAAGATAAGAGAATGTATAGAGTAA
AA sequence
>Potri.016G027201.1 pacid=42810293 polypeptide=Potri.016G027201.1.p locus=Potri.016G027201 ID=Potri.016G027201.1.v4.1 annot-version=v4.1
MMIKHGYPLAMVQHEFFEIFVKNLQPVFKLYSKDVVEADVLAICRQEKEKLISFFDNLSCLLSLTLELRSSNDKMMNYCCFTVHFIDDGWQLKKKILAFR
NLRYNYDMGTVHKVFNSVLTEWSINKNVRFIFLDVTPPKDHTIGELRSKVSDQAPPIHRHLFCVPSYAQILSLLAQDGFSEIRSVLYKIRECIE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G42170 BED zinc finger ;hAT family di... Potri.016G027201 0 1
AT2G27150 AtAAO3, At-AO3,... Arabidopsis thaliana aldehyde ... Potri.004G191300 5.29 0.7751 Pt-AAO3.3,AAO2
AT3G14460 LRR and NB-ARC domains-contain... Potri.017G137801 8.71 0.8114
AT5G36930 Disease resistance protein (TI... Potri.006G283800 9.16 0.7791
AT5G27550 P-loop containing nucleoside t... Potri.005G030484 10.95 0.7952
AT3G14470 NB-ARC domain-containing disea... Potri.014G003832 13.60 0.7925
AT5G36930 Disease resistance protein (TI... Potri.006G282900 13.85 0.7930
AT1G02170 AtMCP1b, ATMC1,... LSD ONE LIKE 3, ARABIDOPSIS TH... Potri.012G112700 16.12 0.7558
AT3G14470 NB-ARC domain-containing disea... Potri.014G002900 20.97 0.7598
AT3G54140 ATPTR1 ARABIDOPSIS THALIANA PEPTIDE T... Potri.005G233500 21.97 0.7339
AT3G11080 AtRLP35 receptor like protein 35 (.1) Potri.012G010300 28.98 0.7298

Potri.016G027201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.