Potri.016G027600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G029500 44 / 7e-06 ND /
Potri.006G028500 42 / 2e-05 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035720 51 / 3e-08 AT3G56910 40 / 2e-04 plastid-specific 50S ribosomal protein 5 (.1)
Lus10037307 48 / 3e-07 AT3G56910 39 / 6e-04 plastid-specific 50S ribosomal protein 5 (.1)
PFAM info
Representative CDS sequence
>Potri.016G027600.2 pacid=42809013 polypeptide=Potri.016G027600.2.p locus=Potri.016G027600 ID=Potri.016G027600.2.v4.1 annot-version=v4.1
ATGCCCCTCCTTCTCTCCAATCCTCTCACCTCGCTCTCTTCACTTCCCCCCTTTTCATCTCCAACTTTGGCCTTCATTGCAACACCAGTTTCCAGGCTGG
ACGTGAAAGCCTTTGAATTAAAGTTTAAGACTTGGAATGGAGTCCGGTTTCAAAACCCAATTCGTGGAAACAGAATTGGTGCAGTTATTGTGAGAGCTTC
TTCGGATATTGATGGAACCGCTCCTACAGAGACAAGTGAGCCTCCTGTAGAAAGTAAAGAGGAGGTTGTGGCAGTTGATAAGTTGCCATTGGAGTCAAAG
TTACAGGAGAGAGAAGAACAGAAGATGAAGATGAAATTGGCGAGAAAGATCAGGCTTCGAAGGAATAGGCTTGTTAGGAAGAGGAGGATGAGAAAGAAGG
GTCGTTGGCCGCCTTCTAAGATGAAGAAGTTGAAGAATGTCTGA
AA sequence
>Potri.016G027600.2 pacid=42809013 polypeptide=Potri.016G027600.2.p locus=Potri.016G027600 ID=Potri.016G027600.2.v4.1 annot-version=v4.1
MPLLLSNPLTSLSSLPPFSSPTLAFIATPVSRLDVKAFELKFKTWNGVRFQNPIRGNRIGAVIVRASSDIDGTAPTETSEPPVESKEEVVAVDKLPLESK
LQEREEQKMKMKLARKIRLRRNRLVRKRRMRKKGRWPPSKMKKLKNV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G56910 PSRP5 plastid-specific 50S ribosomal... Potri.016G027600 0 1
AT5G17670 alpha/beta-Hydrolases superfam... Potri.013G070700 3.87 0.9703
AT5G40950 RPL27 ribosomal protein large subuni... Potri.001G329500 4.24 0.9762 Pt-RPL27.5
AT2G26500 cytochrome b6f complex subunit... Potri.004G147300 4.89 0.9744
AT1G32470 Single hybrid motif superfamil... Potri.003G089300 8.24 0.9697 gdcH3,Pt-GDCH.3
AT3G27160 GHS1 GLUCOSE HYPERSENSITIVE 1, Ribo... Potri.001G331600 9.48 0.9671 GHS1.1
AT3G04760 Pentatricopeptide repeat (PPR-... Potri.013G047000 9.89 0.9643
AT1G64150 Uncharacterized protein family... Potri.003G134300 10.95 0.9641
AT1G29070 Ribosomal protein L34 (.1) Potri.011G064800 11.40 0.9684
AT4G02530 chloroplast thylakoid lumen pr... Potri.006G067600 14.69 0.9639
AT3G44020 thylakoid lumenal P17.1 protei... Potri.009G155700 14.83 0.9595

Potri.016G027600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.