Potri.016G028501 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G028400 254 / 3e-86 ND /
Potri.016G028600 223 / 5e-74 ND /
Potri.006G031300 209 / 5e-68 ND /
Potri.019G021900 52 / 8e-08 AT3G11770 77 / 3e-17 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.011G116000 47 / 2e-06 AT3G12410 91 / 2e-22 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G031400 44 / 3e-05 AT3G12410 101 / 2e-26 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010357 52 / 1e-07 AT3G11770 66 / 7e-13 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10036491 50 / 3e-07 AT3G11770 64 / 4e-12 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10039164 48 / 1e-06 AT4G13870 105 / 2e-27 Werner syndrome-like exonuclease (.1.2)
Lus10013769 48 / 2e-06 AT4G13870 105 / 4e-27 Werner syndrome-like exonuclease (.1.2)
Lus10043049 42 / 0.0001 AT2G36110 121 / 4e-34 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029478 42 / 0.0001 AT5G48350 82 / 2e-19 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Representative CDS sequence
>Potri.016G028501.1 pacid=42809188 polypeptide=Potri.016G028501.1.p locus=Potri.016G028501 ID=Potri.016G028501.1.v4.1 annot-version=v4.1
ATGAAAAGCTTTAATCTTCGCTCTATTTGTTTGGGTGGGAATGATCGTGAGGGCGTTGAGATTTTTGATGTGCAATGTGACAACATGCGCTGTACCGCAA
CCGTTACTAGTAATGCTGCACGCCTCATGGATCTGATTGGTAACCTATGTAAATTGGTTACCACCCCAAATAGTGGCACAAGACTGAGGGTATCCATGGA
CATGATATGGGACAAGCCAGTTGATGATGATGCCGAGGTCGACCCTCCTGTTACTCTTCAGTTCTGTTATGAGCATTTTTGCATCATCTATCATGTTAAT
CCTCCAGATAATTTTCCAACGTCTTCTCTGGAGAACTTCTTGAATCACGATTGCATAGATTTTTTCGGCTTCGAAATGAAGCCCAAAGTCGAATATCTTC
GTCGGGCATATAACCTTGTTGTGAAAAACTGGTTTGATATCCCATCTGAAGCCCGTCTTTCAAATCCAGCCAGGTTTGGTGACAAGGTGGATTTGTCTCT
ACAAGAAATGGTATCCATGGATTTCTCAAGGGAGTATTCAAAGGCTACTGACCTTCTTCAGAGCAACTGGAGGTCGAGTAAACTTTCTACTGATCAAGTA
ATAAACGCGGCCCTAGATTGTTATTTTGCCTACAAGTTTGCAGTTCGGGTCTCAATTTGTCCTCGTTCAGATTAG
AA sequence
>Potri.016G028501.1 pacid=42809188 polypeptide=Potri.016G028501.1.p locus=Potri.016G028501 ID=Potri.016G028501.1.v4.1 annot-version=v4.1
MKSFNLRSICLGGNDREGVEIFDVQCDNMRCTATVTSNAARLMDLIGNLCKLVTTPNSGTRLRVSMDMIWDKPVDDDAEVDPPVTLQFCYEHFCIIYHVN
PPDNFPTSSLENFLNHDCIDFFGFEMKPKVEYLRRAYNLVVKNWFDIPSEARLSNPARFGDKVDLSLQEMVSMDFSREYSKATDLLQSNWRSSKLSTDQV
INAALDCYFAYKFAVRVSICPRSD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.016G028501 0 1
AT1G54400 HSP20-like chaperones superfam... Potri.013G054800 7.87 0.9451
AT4G33490 Eukaryotic aspartyl protease f... Potri.007G099200 10.58 0.9375
AT4G31980 unknown protein Potri.003G209300 12.24 0.9328
AT2G27140 HSP20-like chaperones superfam... Potri.004G191101 13.03 0.9369
AT1G65810 P-loop containing nucleoside t... Potri.004G077600 14.96 0.9299
AT3G50120 Plant protein of unknown funct... Potri.001G071200 15.87 0.9222
AT5G42930 alpha/beta-Hydrolases superfam... Potri.005G138800 15.87 0.9188
AT2G27140 HSP20-like chaperones superfam... Potri.004G191200 17.34 0.9301
AT4G03500 Ankyrin repeat family protein ... Potri.011G016100 17.74 0.9289
AT1G60500 DRP4C Dynamin related protein 4C (.1... Potri.013G119900 19.74 0.9273

Potri.016G028501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.