Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36110 103 / 4e-27 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT4G13870 104 / 5e-27 WRNEXO, ATWRNEXO, WEX, ATWEX Werner syndrome-like exonuclease (.1.2) AT3G12430 98 / 6e-25 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT3G12410 98 / 6e-25 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT3G12460 91 / 3e-22 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT3G12470 87 / 7e-21 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT3G12420 73 / 5e-16 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT5G48350 65 / 7e-13 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT3G12440 63 / 1e-11 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT3G62320 49 / 2e-07 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G031400 [exp] 361 / 2e-128 AT3G12410 101 / 2e-26 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.011G116000 [exp] 146 / 3e-44 AT3G12410 91 / 2e-22 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.017G059200 [exp] 92 / 4e-22 AT4G13870 288 / 4e-97 Werner syndrome-like exonuclease (.1.2) Potri.019G021900 [exp] 70 / 2e-14 AT3G11770 77 / 3e-17 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.002G185500 [exp] 59 / 1e-10 AT3G12410 45 / 1e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.005G020000 [exp] 59 / 4e-10 AT1G56310 655 / 0.0 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.013G049000 [exp] 45 / 1e-05 AT5G06450 / Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.006G031300 [exp] 43 / 5e-05 ND /
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039164 [exp] 273 / 1e-93 AT4G13870 105 / 2e-27 Werner syndrome-like exonuclease (.1.2) Lus10013769 [exp] 268 / 1e-91 AT4G13870 105 / 4e-27 Werner syndrome-like exonuclease (.1.2) Lus10029479 [exp] 124 / 2e-35 AT2G36110 87 / 4e-21 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10029478 [exp] 121 / 2e-34 AT5G48350 82 / 2e-19 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10039591 [exp] 120 / 6e-34 AT3G12410 86 / 1e-20 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10043049 [exp] 117 / 2e-32 AT2G36110 121 / 4e-34 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10022556 [exp] 81 / 6e-18 AT4G13870 246 / 1e-80 Werner syndrome-like exonuclease (.1.2) Lus10036491 [exp] 57 / 9e-10 AT3G11770 64 / 4e-12 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10010357 [exp] 57 / 1e-09 AT3G11770 66 / 7e-13 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10010930 [exp] 54 / 2e-08 AT1G56310 640 / 0.0 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0219 [poplar] [flax] RNase_H PF01612 [poplar] [flax] DNA_pol_A_exo1 3'-5' exonuclease
Representative CDS sequence Show only first row Show all	>Potri.016G028700.1 pacid=42809091 polypeptide=Potri.016G028700.1.p locus=Potri.016G028700 ID=Potri.016G028700.1.v4.1 annot-version=v4.1 ATGGCAATCAGCATTGAAAACCACCACCTCCCGTACGAAACACACAACCTCTACGATGTCAAATTCTTCGATGACAGGATCCACACTTTAGTCACCCACA CGTCTTCCTTCGTCAACACATGGATCGCCGAAACCCAACAAAAACTCCTCCAAAACAACAACCATGCTCACCGTCCACTTATAGTTGGCCTTGACGTCGA GTGGAGGCCCAACAGGTTCCGTCGAATCGAAAACCCAGTTGCCACACTCCAGCTTTCAGCTGGCAATGACTGCTTGATCTTTCAACTCCTGCATTGTCCC ACTGGTATCCCACAATCCCTTCATGATTTTTTGAGTGACATGACTTATACTTTTGTTGGGGTGGGTATTGAGGGTGATGTGAAGAAGCTAACGGAGGATT ATGAGCTGAGCGTGGGGAATGCAGTGGATTTAAGGGGTTTAGCTGCTGAGAAATTGGGGGATTCGAGGTGGAAGAATTCAGGGGTAAAAAGGTTGGCGAG GGAAGTTTTGGGGAAGGAGATTGAGAAGCCGAAAAGGATCACTCTGAGTAGGTGGGACAATCCGTGGCTTACTCCTGCTCAAGTTCAATATGCTTGTCTT GATGCCTTTTTGTCTTGCAAGATTGGGGAGAGTTTGGTGGCTGCTTGA
AA sequence Show only first row Show all	>Potri.016G028700.1 pacid=42809091 polypeptide=Potri.016G028700.1.p locus=Potri.016G028700 ID=Potri.016G028700.1.v4.1 annot-version=v4.1 MAISIENHHLPYETHNLYDVKFFDDRIHTLVTHTSSFVNTWIAETQQKLLQNNNHAHRPLIVGLDVEWRPNRFRRIENPVATLQLSAGNDCLIFQLLHCP TGIPQSLHDFLSDMTYTFVGVGIEGDVKKLTEDYELSVGNAVDLRGLAAEKLGDSRWKNSGVKRLAREVLGKEIEKPKRITLSRWDNPWLTPAQVQYACL DAFLSCKIGESLVAA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G13870		WRNEXO, ATWRNEX...	Werner syndrome-like exonuclea...		Potri.016G028700 [exp]	0	1
AT4G39700			Heavy metal transport/detoxifi...		Potri.007G087300 [exp]	2.82	0.9269
AT3G15800			Glycosyl hydrolase superfamily...		Potri.003G032600 [exp]	8.18	0.9287
AT3G50120			Plant protein of unknown funct...		Potri.003G159300 [exp]	10.39	0.9238
AT3G15680			Ran BP2/NZF zinc finger-like s...		Potri.003G061300 [exp]	12.00	0.9024
AT5G51160			Ankyrin repeat family protein ...		Potri.014G050700 [exp]	15.09	0.9244
AT5G18970			AWPM-19-like family protein (....		Potri.008G200000 [exp]	15.16	0.9216
AT3G18670			Ankyrin repeat family protein ...		Potri.007G110000 [exp]	18.97	0.9232
AT2G27140			HSP20-like chaperones superfam...		Potri.009G153000 [exp]	20.49	0.9238
AT2G34540			unknown protein		Potri.004G064900 [exp]	21.49	0.9226
AT3G05620			Plant invertase/pectin methyle...		Potri.005G022700 [exp]	22.04	0.9217

Compare expression of checked genes

Potri.016G028700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.