Plant FIBer expression Database

Potri.016G028800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G081350
[exp]
231 / 2e-79 ND /
Potri.006G031500
[exp]
174 / 6e-57 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.016G028800.1 pacid=42810057 polypeptide=Potri.016G028800.1.p locus=Potri.016G028800 ID=Potri.016G028800.1.v4.1 annot-version=v4.1
ATGGCAGAGAAAAACAACATTGAAAAACCTTCCAAAAATCAAGATTCCAGCCAAGACCCACCATTACAAGCTACTTCTTCTTCAAGCCGGGAACTCAAGA
AAGAAAAGCAAGGAACAATCAGAGAATCCAAGAGGAGAAAAAGCTGCCCTACAGCACTCGACAGGATTGAAGAATTCACTCCACCGAACTTTTCCTTCAC
TTTTGACTCCCAATTCAGCACCTATTCTCAAGAATTCACACCCAAATTCGGATCTTTCAACTTGGTGCCATCAACCAAAGAAAGATTGGATGATACTGTT
CTCTGTTTTCATCAGAGCTCAGAAAACAAAGAAGGCCATCAAGAAGATAAGCAGCAGGTAGGGGTTAGTGAAGAAAGAGTGGTCGGTGTTAGCACATTGA
GGAGGTCCATTGATGGGATTAGAGAGAAGAAGTGA
AA sequence
>Potri.016G028800.1 pacid=42810057 polypeptide=Potri.016G028800.1.p locus=Potri.016G028800 ID=Potri.016G028800.1.v4.1 annot-version=v4.1
MAEKNNIEKPSKNQDSSQDPPLQATSSSSRELKKEKQGTIRESKRRKSCPTALDRIEEFTPPNFSFTFDSQFSTYSQEFTPKFGSFNLVPSTKERLDDTV
LCFHQSSENKEGHQEDKQQVGVSEERVVGVSTLRRSIDGIREKK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.016G028800
[exp]
0 1
AT3G12410 Polynucleotidyl transferase, r... Potri.006G031400
[exp]
3.16 0.8055
Potri.001G062100
[exp]
3.31 0.8220
AT4G28440 Nucleic acid-binding, OB-fold-... Potri.017G014400
[exp]
3.74 0.8200
AT1G71865 unknown protein Potri.019G086700
[exp]
11.83 0.7871
AT2G39840 TOPP4 type one serine/threonine prot... Potri.019G018000
[exp]
11.91 0.7305
AT2G28230 TATA-binding related factor (T... Potri.006G143400
[exp]
11.95 0.7848
Potri.005G182850
[exp]
12.64 0.6973
AT4G03170 B3 AP2/B3-like transcriptional fa... Potri.001G397100
[exp]
13.71 0.8065
AT2G36330 Uncharacterised protein family... Potri.012G079800
[exp]
17.32 0.7614
Potri.001G387000
[exp]
19.36 0.7832

Potri.016G028800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.