Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47570 108 / 4e-28 Leucine-rich repeat protein kinase family protein (.1) AT3G47090 105 / 7e-27 Leucine-rich repeat protein kinase family protein (.1) AT3G47580 104 / 1e-26 Leucine-rich repeat protein kinase family protein (.1) AT3G47110 90 / 1e-21 Leucine-rich repeat protein kinase family protein (.1) AT5G20480 87 / 1e-20 EFR EF-TU receptor (.1) AT1G01540 82 / 5e-19 Protein kinase superfamily protein (.1.2) AT5G39390 82 / 7e-19 Leucine-rich repeat protein kinase family protein (.1) AT4G02630 80 / 4e-18 Protein kinase superfamily protein (.1) AT1G66150 80 / 4e-18 TMK1 transmembrane kinase 1 (.1) AT5G46330 80 / 5e-18 FLS2 FLAGELLIN-SENSITIVE 2, Leucine-rich receptor-like protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G029900 [exp] 229 / 6e-71 AT3G47570 645 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.011G141001 [exp] 160 / 5e-49 AT3G47570 256 / 2e-77 Leucine-rich repeat protein kinase family protein (.1) Potri.011G068500 [exp] 158 / 2e-45 AT5G46330 505 / 1e-159 FLAGELLIN-SENSITIVE 2, Leucine-rich receptor-like protein kinase family protein (.1) Potri.003G150000 [exp] 119 / 5e-32 AT3G47570 506 / 4e-162 Leucine-rich repeat protein kinase family protein (.1) Potri.015G037400 [exp] 116 / 7e-31 AT3G47570 786 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.012G044500 [exp] 112 / 3e-29 AT3G47570 764 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.003G150100 [exp] 110 / 8e-29 AT3G47570 503 / 4e-161 Leucine-rich repeat protein kinase family protein (.1) Potri.008G007866 [exp] 107 / 1e-27 AT3G47570 770 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.017G115900 [exp] 103 / 3e-26 AT3G47570 810 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004827 [exp] 112 / 2e-29 AT3G47570 812 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10037840 [exp] 103 / 4e-26 AT3G47570 815 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10037954 [exp] 97 / 1e-24 AT3G47570 261 / 7e-84 Leucine-rich repeat protein kinase family protein (.1) Lus10033363 [exp] 99 / 2e-24 AT3G47570 758 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10031043 [exp] 97 / 4e-24 AT3G47570 756 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030630 [exp] 97 / 5e-24 AT3G47570 426 / 8e-137 Leucine-rich repeat protein kinase family protein (.1) Lus10030846 [exp] 97 / 5e-24 AT3G47570 749 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10011387 [exp] 96 / 9e-24 AT3G47570 782 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10037310 [exp] 96 / 1e-23 AT3G47570 744 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030587 [exp] 96 / 2e-23 AT3G47570 776 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.016G029800.1 pacid=42810668 polypeptide=Potri.016G029800.1.p locus=Potri.016G029800 ID=Potri.016G029800.1.v4.1 annot-version=v4.1 ATGAATTTCATGAGAGTAATCTGCTGGGCGTTGGAAGTTATGGCTCTGTGTATCAATGTGTTACTAGATGAGGACATGGTTGCGCACGGATGTGATTTCG GCATAGCAAAACTCTTAGGTGAAAGCGAATCCATTGCACAAACCAAGACCCTTGCCACGATAGGGTATATGGCACCAGAATATGGACTGGATGGTCTTGT GTCCACCAAGATTGATGTCTACAGCTTTGGGATCATGTTGATGGAAATATTCACGCGAAAAAAGCCTGCTGATGAAATGTTTGAGGGAGAAATGAGCCTA AAGAGATTGGTGAAAGAATCCTTGCCTGATTCTGTAATTGACATTGTAGATAGCAACATGCAGAATAGAAGAGATGGATATTCAGTAAATAAGGAGCACT GTGTCACATCTATAATGGAAGTTGGCTTTGCAATGTACTTATGA
AA sequence Show only first row Show all	>Potri.016G029800.1 pacid=42810668 polypeptide=Potri.016G029800.1.p locus=Potri.016G029800 ID=Potri.016G029800.1.v4.1 annot-version=v4.1 MNFMRVICWALEVMALCINVLLDEDMVAHGCDFGIAKLLGESESIAQTKTLATIGYMAPEYGLDGLVSTKIDVYSFGIMLMEIFTRKKPADEMFEGEMSL KRLVKESLPDSVIDIVDSNMQNRRDGYSVNKEHCVTSIMEVGFAMYL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G47570			Leucine-rich repeat protein ki...		Potri.016G029800 [exp]	0	1
AT2G16050			Cysteine/Histidine-rich C1 dom...		Potri.010G204600 [exp]	6.00	0.7553
AT5G51810		AT2353, GA20OX2...	gibberellin 20 oxidase 2 (.1)		Potri.012G132400 [exp]	9.79	0.7509	Pt-GA20.1,GA20ox6
AT2G40160		TBL30	Plant protein of unknown funct...		Potri.008G070101 [exp]	21.63	0.7053
					Potri.019G053150 [exp]	21.97	0.6073
AT4G35280	C2H2ZnF	DAZ2	DUO1-ACTIVATED ZINC FINGER 2, ...		Potri.004G205300 [exp]	23.32	0.6083
AT5G18980			ARM repeat superfamily protein...		Potri.008G200500 [exp]	25.29	0.6758
AT5G66815			unknown protein		Potri.014G034500 [exp]	26.83	0.6765
AT5G41460			Protein of unknown function (D...		Potri.015G106101 [exp]	26.98	0.6832
					Potri.002G200150 [exp]	27.71	0.7159
AT2G37440			DNAse I-like superfamily prote...		Potri.017G074200 [exp]	29.56	0.6428

Compare expression of checked genes

Potri.016G029800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.