Potri.016G030100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G16240 266 / 2e-90 ATSYP51, SYP51 syntaxin of plants 51 (.1.2.3)
AT1G79590 266 / 2e-90 ATSYP52, SYP52 syntaxin of plants 52 (.1.2)
AT1G16230 178 / 2e-56 Target SNARE coiled-coil domain protein (.1)
AT1G16225 130 / 9e-38 Target SNARE coiled-coil domain protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G032800 379 / 3e-135 AT1G79590 238 / 2e-79 syntaxin of plants 52 (.1.2)
Potri.006G032900 369 / 4e-131 AT1G79590 249 / 1e-83 syntaxin of plants 52 (.1.2)
Potri.016G030200 350 / 1e-123 AT1G79590 246 / 9e-83 syntaxin of plants 52 (.1.2)
Potri.004G050800 54 / 1e-08 AT1G28490 297 / 2e-102 syntaxin of plants 61 (.1.2)
Potri.011G059700 48 / 1e-06 AT1G28490 310 / 2e-107 syntaxin of plants 61 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016577 265 / 4e-90 AT1G79590 319 / 1e-111 syntaxin of plants 52 (.1.2)
Lus10002446 240 / 2e-80 AT1G16240 265 / 2e-90 syntaxin of plants 51 (.1.2.3)
Lus10017686 47 / 6e-06 AT1G28490 299 / 8e-103 syntaxin of plants 61 (.1.2)
Lus10018642 44 / 4e-05 AT1G28490 334 / 7e-117 syntaxin of plants 61 (.1.2)
Lus10039880 41 / 0.0004 AT1G28490 271 / 4e-91 syntaxin of plants 61 (.1.2)
Lus10014759 40 / 0.001 AT3G09740 308 / 4e-102 syntaxin of plants 71 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05739 SNARE SNARE domain
Representative CDS sequence
>Potri.016G030100.3 pacid=42810333 polypeptide=Potri.016G030100.3.p locus=Potri.016G030100 ID=Potri.016G030100.3.v4.1 annot-version=v4.1
ATGTCAACGCCATCGGCGTCATGGATGCAAGAATTCAATGAAGCATCAAAACTGGGTGATGAAATTAATGGTATGATTTCTGGGAAGAATTCTTTGCCTT
CATCAGGACCAGAAACACAAAGGCATCTTTCCGCAAGTAGGAGAAAGATCACTATTTTAAGAACTAAACTTGATATTTTGCAGTCCCTTTTGTCAGAACT
TCCTAGCAAGCAACCAATAACAGGGAAAGAGATGAATCGACGTCAAGACATGCTGAAAAATCTGAGTACTAAAGTTAACCAGATGGCTAGTATTCTCAAT
ATGTCCAGTGCTGCTAACAGAGAGAACTTGCTTGGGCCTGATAAGAAGACAGATGATATCATGAATAGAGCAACTGGCTTGAACAACCATGGTCTTGTTG
GCTTTCAACGGCAAATTATGAAAGAACAAGATCAAGGCCTTGAGAAATTGGAGGAGACAGTGATAAGTACGAAACACATTGCTTTGGCTGTCAACGAGGA
ACTTTCCCTGCACACTAGGCTTCTGGATGACTTGGATGAGCACGTGGATGTAACAAATTCTCGTCTACAGATGGTTCAAAGGAAATTGGCTTTTCTGAAC
AAAAGCACCAAGGGCGGCCGCTCTTGCTGGATCTTGTTGGTCATTGCCGTTGTCATTCTAATTGTTGTGATATGGCAACTGTTTCAACATTTGTAA
AA sequence
>Potri.016G030100.3 pacid=42810333 polypeptide=Potri.016G030100.3.p locus=Potri.016G030100 ID=Potri.016G030100.3.v4.1 annot-version=v4.1
MSTPSASWMQEFNEASKLGDEINGMISGKNSLPSSGPETQRHLSASRRKITILRTKLDILQSLLSELPSKQPITGKEMNRRQDMLKNLSTKVNQMASILN
MSSAANRENLLGPDKKTDDIMNRATGLNNHGLVGFQRQIMKEQDQGLEKLEETVISTKHIALAVNEELSLHTRLLDDLDEHVDVTNSRLQMVQRKLAFLN
KSTKGGRSCWILLVIAVVILIVVIWQLFQHL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G79590 ATSYP52, SYP52 syntaxin of plants 52 (.1.2) Potri.016G030100 0 1
AT5G16600 MYB ATMYB43 myb domain protein 43 (.1) Potri.004G086300 2.00 0.7167
AT1G77120 ADH1, ATADH, AT... ARABIDOPSIS THALIANA ALCOHOL D... Potri.002G072100 8.12 0.6444
AT5G67480 ATBT4, BT4 BTB and TAZ domain protein 4 (... Potri.007G055100 11.40 0.6664
AT2G25355 PNAS-3 related (.1.2) Potri.015G075400 18.89 0.7045
AT4G39070 CO B-box zinc finger family prote... Potri.009G122000 23.23 0.7009
AT4G04960 Concanavalin A-like lectin pro... Potri.011G053100 33.04 0.6741
AT5G06610 Protein of unknown function (D... Potri.016G062400 34.81 0.6632
AT1G12000 Phosphofructokinase family pro... Potri.004G003800 37.06 0.6805
AT1G66180 Eukaryotic aspartyl protease f... Potri.004G085000 39.33 0.6559
AT1G47740 PPPDE putative thiol peptidase... Potri.002G134200 41.56 0.5978

Potri.016G030100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.