Potri.016G031166 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.016G031166.1 pacid=42809647 polypeptide=Potri.016G031166.1.p locus=Potri.016G031166 ID=Potri.016G031166.1.v4.1 annot-version=v4.1
ATGCAGCTTGTGAATGCCAAAGGTCTATTCAGAAGATCACAAGCATACTTGAAAACATCTGAATTAGAGAAAGCTGAAGCAGAAGCAGATATAAAGAAAG
CTCTAGCCATTGATCCTAATAATCGATACCAGAGAGAAATGAACCAGAAACATCTCTCATCTTGCAATCTTAAATGGGCCATTAAATTTCTCTGCAGCTA
CTTTCACATCCACTGCTCTGCAAGCCTTAAATGGGTCATGCATAGTTATTAA
AA sequence
>Potri.016G031166.1 pacid=42809647 polypeptide=Potri.016G031166.1.p locus=Potri.016G031166 ID=Potri.016G031166.1.v4.1 annot-version=v4.1
MQLVNAKGLFRRSQAYLKTSELEKAEAEADIKKALAIDPNNRYQREMNQKHLSSCNLKWAIKFLCSYFHIHCSASLKWVMHSY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.016G031166 0 1
Potri.016G031232 2.00 0.9921
AT4G27290 S-locus lectin protein kinase ... Potri.011G128600 3.00 0.9651
AT2G30600 BTB/POZ domain-containing prot... Potri.005G251300 3.31 0.9303
AT1G29350 Kinase-related protein of unkn... Potri.002G059300 4.89 0.9492
AT2G40840 DPE2 disproportionating enzyme 2 (.... Potri.006G031700 6.32 0.9535
AT1G01320 Tetratricopeptide repeat (TPR)... Potri.014G098600 6.32 0.9595
AT5G14180 MPL1 Myzus persicae-induced lipase ... Potri.014G159800 7.00 0.9377
AT1G26230 Cpn60beta4 chaperonin-60beta4, TCP-1/cpn6... Potri.010G135100 9.79 0.9346
AT2G29380 HAI3 highly ABA-induced PP2C gene 3... Potri.001G245200 10.09 0.8951
AT2G29940 ABCG31, PDR3, A... ATP-binding cassette G31, plei... Potri.009G045601 10.39 0.9290

Potri.016G031166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.