Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56630 221 / 4e-71 CYP94D2 "cytochrome P450, family 94, subfamily D, polypeptide 2", cytochrome P450, family 94, subfamily D, polypeptide 2 (.1) AT1G34540 216 / 5e-69 CYP94D1 "cytochrome P450, family 94, subfamily D, polypeptide 1", cytochrome P450, family 94, subfamily D, polypeptide 1 (.1) AT5G23190 166 / 1e-49 CYP86B1 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) AT5G08250 165 / 1e-49 Cytochrome P450 superfamily protein (.1) AT1G13140 164 / 3e-49 CYP86C3 "cytochrome P450, family 86, subfamily C, polypeptide 3", cytochrome P450, family 86, subfamily C, polypeptide 3 (.1.2) AT2G45510 160 / 1e-47 CYP704A2 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) AT2G27690 158 / 7e-47 CYP94C1 "cytochrome P450, family 94, subfamily C, polypeptide 1", cytochrome P450, family 94, subfamily C, polypeptide 1 (.1) AT1G13150 159 / 8e-47 CYP86C4 "cytochrome P450, family 86, subfamily C, polypeptide 4", cytochrome P450, family 86, subfamily C, polypeptide 4 (.1) AT3G26125 158 / 1e-46 CYP86C2 "cytochrome P450, family 86, subfamily C, polypeptide 2", cytochrome P450, family 86, subfamily C, polypeptide 2 (.1) AT2G45970 156 / 6e-46 CYP86A8, LCR LACERATA, "cytochrome P450, family 86, subfamily A, polypeptide 8", cytochrome P450, family 86, subfamily A, polypeptide 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G031700 [exp] 312 / 2e-106 AT3G56630 629 / 0.0 "cytochrome P450, family 94, subfamily D, polypeptide 2", cytochrome P450, family 94, subfamily D, polypeptide 2 (.1) Potri.006G033600 [exp] 273 / 3e-91 AT3G56630 576 / 0.0 "cytochrome P450, family 94, subfamily D, polypeptide 2", cytochrome P450, family 94, subfamily D, polypeptide 2 (.1) Potri.001G277305 [exp] 183 / 4e-59 AT3G56630 225 / 4e-71 "cytochrome P450, family 94, subfamily D, polypeptide 2", cytochrome P450, family 94, subfamily D, polypeptide 2 (.1) Potri.010G236700 [exp] 172 / 2e-52 AT2G27690 576 / 0.0 "cytochrome P450, family 94, subfamily C, polypeptide 1", cytochrome P450, family 94, subfamily C, polypeptide 1 (.1) Potri.009G145400 [exp] 171 / 9e-52 AT2G27690 622 / 0.0 "cytochrome P450, family 94, subfamily C, polypeptide 1", cytochrome P450, family 94, subfamily C, polypeptide 1 (.1) Potri.004G185300 [exp] 171 / 1e-51 AT2G27690 604 / 0.0 "cytochrome P450, family 94, subfamily C, polypeptide 1", cytochrome P450, family 94, subfamily C, polypeptide 1 (.1) Potri.013G075600 [exp] 166 / 9e-50 AT2G27690 585 / 0.0 "cytochrome P450, family 94, subfamily C, polypeptide 1", cytochrome P450, family 94, subfamily C, polypeptide 1 (.1) Potri.014G072300 [exp] 163 / 9e-49 AT2G45510 563 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Potri.014G072100 [exp] 158 / 1e-46 AT2G45510 563 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015018 [exp] 167 / 9e-50 AT2G45510 586 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Lus10019534 [exp] 154 / 6e-49 AT2G27690 208 / 4e-66 "cytochrome P450, family 94, subfamily C, polypeptide 1", cytochrome P450, family 94, subfamily C, polypeptide 1 (.1) Lus10038896 [exp] 163 / 1e-48 AT2G45510 582 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Lus10043378 [exp] 155 / 2e-47 AT2G27690 341 / 1e-115 "cytochrome P450, family 94, subfamily C, polypeptide 1", cytochrome P450, family 94, subfamily C, polypeptide 1 (.1) Lus10017394 [exp] 159 / 1e-46 AT5G23190 739 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Lus10010193 [exp] 158 / 2e-46 AT5G23190 741 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Lus10040986 [exp] 158 / 3e-46 AT5G23190 751 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Lus10018831 [exp] 151 / 8e-46 AT4G00360 403 / 8e-139 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1) Lus10036024 [exp] 155 / 1e-45 AT3G56630 380 / 3e-127 "cytochrome P450, family 94, subfamily D, polypeptide 2", cytochrome P450, family 94, subfamily D, polypeptide 2 (.1) Lus10018217 [exp] 154 / 6e-45 AT5G58860 802 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.016G031850.1 pacid=42809619 polypeptide=Potri.016G031850.1.p locus=Potri.016G031850 ID=Potri.016G031850.1.v4.1 annot-version=v4.1 ATGCATTATTTGCAGGCAGCTATTGCAGAGACATTAAGATTGTATCCACCAGTGCCAGTGGATACAAAAGCTTGCCAAAGTGATGATGTATTGCCAGACG GTACATTTGTGGGAAAGAATTGGTTTGTAACATATCACGCGTATGCCATGGGAAGGATGGAGAGTATCTGGGGCAAGAATTGCCGCGATTTTGTTCCTGA AAGATGGCTAGAGAATGGAATATACAGGCAAGAGAGTCCATTCAAGTTTCCTGTTTTCCATGCTGGGCCAAGAATGTGTCTGGGGAAAGACATGGCCTAT ATCCAGATGAAATCCATTGCAGCATCGGTGATTGAGCGATTTGAGATTGATGTGCAGAACAAGGAAAAGTGCCCGGATCATTTGTTGTCCTTGACACTAA GGATGAAAGGTGGATTGCAGGTTAAGGTGAAGGAAAGATGA
AA sequence Show only first row Show all	>Potri.016G031850.1 pacid=42809619 polypeptide=Potri.016G031850.1.p locus=Potri.016G031850 ID=Potri.016G031850.1.v4.1 annot-version=v4.1 MHYLQAAIAETLRLYPPVPVDTKACQSDDVLPDGTFVGKNWFVTYHAYAMGRMESIWGKNCRDFVPERWLENGIYRQESPFKFPVFHAGPRMCLGKDMAY IQMKSIAASVIERFEIDVQNKEKCPDHLLSLTLRMKGGLQVKVKER

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G56630		CYP94D2	"cytochrome P450, family 94, s...		Potri.016G031850 [exp]	0	1
AT3G59300			Pentatricopeptide repeat (PPR)...		Potri.002G230700 [exp]	3.74	0.9512
AT4G30460			glycine-rich protein (.1)		Potri.006G178200 [exp]	4.00	0.9689
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Potri.016G057400 [exp]	6.00	0.9600
AT2G18660		AtPNP-A, PNP-A,...	plant natriuretic peptide A (....		Potri.006G179300 [exp]	6.00	0.9639
AT3G09390		ATMT-K, ATMT-1,...	ARABIDOPSIS THALIANA METALLOTH...		Potri.009G030800 [exp]	6.70	0.8932
AT3G28960			Transmembrane amino acid trans...		Potri.008G086500 [exp]	7.34	0.9557
AT5G24090		ATCHIA	chitinase A (.1)		Potri.002G165700 [exp]	7.41	0.9569	CHI3.11
AT5G38770		ATGDU7	glutamine dumper 7 (.1)		Potri.004G108440 [exp]	7.74	0.9261
AT5G10770			Eukaryotic aspartyl protease f...		Potri.018G014900 [exp]	9.00	0.9455
AT1G18350		ATMKK7, BUD1	MAP KINASE KINASE7, BUSHY AND ...		Potri.010G049500 [exp]	10.24	0.9335

Compare expression of checked genes

Potri.016G031850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.