Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09550 103 / 5e-31 ATGIP1 ARABIDOPSIS ATGCP3 INTERACTING PROTEIN 1, AtGCP3 interacting protein 1 (.1) AT1G73790 98 / 5e-29 Protein of unknown function (DUF3743) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G035900 [exp] 117 / 9e-37 AT4G09550 100 / 5e-30 ARABIDOPSIS ATGCP3 INTERACTING PROTEIN 1, AtGCP3 interacting protein 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018288 [exp] 101 / 3e-30 AT4G09550 103 / 3e-31 ARABIDOPSIS ATGCP3 INTERACTING PROTEIN 1, AtGCP3 interacting protein 1 (.1) Lus10040621 [exp] 100 / 1e-29 AT4G09550 105 / 9e-32 ARABIDOPSIS ATGCP3 INTERACTING PROTEIN 1, AtGCP3 interacting protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12554 [poplar] [flax] MOZART1 Mitotic-spindle organizing gamma-tubulin ring associated
Representative CDS sequence Show only first row Show all	>Potri.016G034200.2 pacid=42810151 polypeptide=Potri.016G034200.2.p locus=Potri.016G034200 ID=Potri.016G034200.2.v4.1 annot-version=v4.1 ATGGATCCAGAGGCTGCAAAGACTGCAAGGGACTCTTTGAATTTGGCATTTCATATGTCAAACCTTCTTGATACAGGACTTGATCGACACACCCTTTCGG TTCTTATTGCCCTTTGTGATTTGGGTTTGAACCCAGAAGCACTTGCTGCTGTTGTGAAAGAACTCCGGAGAGAACCTGTTTCATCTTCACTGCCAAATTC TAGTGCTCCGGTAGCTAAACCGTAG
AA sequence Show only first row Show all	>Potri.016G034200.2 pacid=42810151 polypeptide=Potri.016G034200.2.p locus=Potri.016G034200 ID=Potri.016G034200.2.v4.1 annot-version=v4.1 MDPEAAKTARDSLNLAFHMSNLLDTGLDRHTLSVLIALCDLGLNPEALAAVVKELRREPVSSSLPNSSAPVAKP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G09550		ATGIP1	ARABIDOPSIS ATGCP3 INTERACTING...		Potri.016G034200 [exp]	0	1
AT3G12587			Oligosaccaryltransferase (.1)		Potri.008G053300 [exp]	5.29	0.7865
AT1G49245			Prefoldin chaperone subunit fa...		Potri.013G072700 [exp]	5.47	0.7607
AT3G48880			RNI-like superfamily protein (...		Potri.016G019500 [exp]	5.47	0.7746
AT5G53650			unknown protein		Potri.012G022900 [exp]	7.14	0.8033
AT1G73177		APC13, BNS	anaphase-promoting complex 13,...		Potri.004G058400 [exp]	10.09	0.7967
AT3G62920			unknown protein		Potri.014G133600 [exp]	10.24	0.7538
					Potri.016G120333 [exp]	10.58	0.7499
AT1G05720			selenoprotein family protein (...		Potri.013G126900 [exp]	14.07	0.7946
AT5G55190		RAN3, ATRAN3	RAN GTPase 3 (.1)		Potri.018G030700 [exp]	25.25	0.7282
AT5G50375		CPI1	cyclopropyl isomerase (.1.2)		Potri.015G093500 [exp]	30.88	0.7339

Compare expression of checked genes

Potri.016G034200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.