Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28110 119 / 6e-33 SCPL45 serine carboxypeptidase-like 45 (.1.2) AT2G33530 113 / 6e-31 SCPL46 serine carboxypeptidase-like 46 (.1) AT1G43780 97 / 9e-25 SCPL44 serine carboxypeptidase-like 44 (.1) AT5G42240 95 / 3e-24 SCPL42 serine carboxypeptidase-like 42 (.1) AT2G12480 94 / 8e-24 SCPL43 serine carboxypeptidase-like 43 (.1.2) AT5G42230 92 / 5e-23 SCPL41 serine carboxypeptidase-like 41 (.1) AT2G24010 71 / 1e-15 SCPL23 serine carboxypeptidase-like 23 (.1) AT4G30610 67 / 2e-14 SCPL24, BRS1 SERINE CARBOXYPEPTIDASE 24 PRECURSOR, BRI1 SUPPRESSOR 1, alpha/beta-Hydrolases superfamily protein (.1) AT3G02110 67 / 3e-14 SCPL25 serine carboxypeptidase-like 25 (.1) AT5G08260 62 / 2e-12 SCPL35 serine carboxypeptidase-like 35 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G036500 [exp] 145 / 4e-43 AT1G28110 619 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.012G105500 [exp] 128 / 2e-36 AT1G28110 751 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.003G164000 [exp] 127 / 2e-36 AT1G28110 758 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.001G065900 [exp] 122 / 4e-34 AT1G28110 766 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.006G036000 [exp] 119 / 3e-33 AT1G28110 548 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.006G036400 [exp] 116 / 4e-32 AT2G33530 547 / 0.0 serine carboxypeptidase-like 46 (.1) Potri.016G034600 [exp] 114 / 3e-31 AT1G28110 563 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.016G034400 [exp] 111 / 4e-30 AT1G28110 566 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.015G104700 [exp] 111 / 4e-30 AT1G28110 715 / 0.0 serine carboxypeptidase-like 45 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042287 [exp] 124 / 7e-35 AT1G28110 598 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10016722 [exp] 122 / 6e-34 AT1G28110 688 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10036016 [exp] 121 / 1e-33 AT1G28110 690 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10040326 [exp] 105 / 8e-28 AT2G33530 436 / 2e-150 serine carboxypeptidase-like 46 (.1) Lus10010331 [exp] 105 / 9e-28 AT1G28110 540 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10013395 [exp] 102 / 9e-27 AT1G28110 534 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10023446 [exp] 101 / 2e-26 AT1G28110 520 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10023447 [exp] 100 / 3e-26 AT2G33530 441 / 2e-152 serine carboxypeptidase-like 46 (.1) Lus10021856 [exp] 100 / 6e-26 AT1G28110 525 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10040324 [exp] 100 / 8e-26 AT2G33530 532 / 0.0 serine carboxypeptidase-like 46 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [poplar] [flax] AB_hydrolase PF00450 [poplar] [flax] Peptidase_S10 Serine carboxypeptidase
Representative CDS sequence Show only first row Show all	>Potri.016G034875.1 pacid=42810321 polypeptide=Potri.016G034875.1.p locus=Potri.016G034875 ID=Potri.016G034875.1.v4.1 annot-version=v4.1 ATGAAATCAAGCTCGGGCTCTCAAACAGATGGTGGGCTCAAACAGAAAGTGGAGATCAAGATTCAGTCGTCTGGAACAAGGACACTAGTGAATGGATTAG CACAGGGGTTGAGACTAAACACAACTGTTCCTTACAGAACCTGGTTCCAGGGAAAACAGGTTGCTGGGTGGACACAAGTATATGGTGATATATTATCTTT TGCAACCATTAGAGGAGCATCACATAGAGCTCCATTTTCACAGCCAAATAGGTCTATTGTGTTGTTTAATGCATTCTTGGAAGGAAAGCAACTACCACAA GCCCTATAG
AA sequence Show only first row Show all	>Potri.016G034875.1 pacid=42810321 polypeptide=Potri.016G034875.1.p locus=Potri.016G034875 ID=Potri.016G034875.1.v4.1 annot-version=v4.1 MKSSSGSQTDGGLKQKVEIKIQSSGTRTLVNGLAQGLRLNTTVPYRTWFQGKQVAGWTQVYGDILSFATIRGASHRAPFSQPNRSIVLFNAFLEGKQLPQ AL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Potri.016G034875 [exp]	0	1
AT1G16445			S-adenosyl-L-methionine-depend...		Potri.007G069400 [exp]	4.47	0.7949
AT3G05700			Drought-responsive family prot...		Potri.005G020900 [exp]	4.89	0.7577
AT3G13350	ARID		HMG (high mobility group) box ...		Potri.011G168800 [exp]	5.29	0.7845
AT1G78780			pathogenesis-related family pr...		Potri.011G108900 [exp]	5.74	0.7344
AT1G05785			Got1/Sft2-like vescicle transp...		Potri.014G151000 [exp]	14.28	0.7519
AT3G60480			unknown protein		Potri.014G054300 [exp]	16.00	0.7484
AT4G35785			RNA-binding (RRM/RBD/RNP motif...		Potri.003G130301 [exp]	17.60	0.7557
					Potri.003G137900 [exp]	22.58	0.7657
AT1G04270		RPS15	cytosolic ribosomal protein S1...		Potri.005G055401 [exp]	24.08	0.7363
AT5G14680			Adenine nucleotide alpha hydro...		Potri.017G071700 [exp]	24.95	0.7505

Compare expression of checked genes

Potri.016G034875 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.