Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56710 48 / 2e-07 SIB1 sigma factor binding protein 1 (.1) AT2G41180 45 / 3e-06 SIB2 sigma factor binding protein 2, VQ motif-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G038900 [exp] 174 / 1e-56 AT2G41180 56 / 2e-10 sigma factor binding protein 2, VQ motif-containing protein (.1) Potri.003G194700 [exp] 63 / 4e-13 AT3G56710 54 / 6e-10 sigma factor binding protein 1 (.1) Potri.001G029700 [exp] 52 / 5e-09 AT3G56710 54 / 5e-10 sigma factor binding protein 1 (.1) Potri.019G013750 [exp] 43 / 1e-05 AT3G56710 46 / 7e-07 sigma factor binding protein 1 (.1) Potri.013G043800 [exp] 41 / 4e-05 AT2G41180 / sigma factor binding protein 2, VQ motif-containing protein (.1) Potri.016G093900 [exp] 41 / 6e-05 AT2G41180 / sigma factor binding protein 2, VQ motif-containing protein (.1) Potri.019G013300 [exp] 40 / 0.0001 AT2G41180 47 / 3e-07 sigma factor binding protein 2, VQ motif-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038985 [exp] 53 / 4e-09 AT3G56710 54 / 3e-09 sigma factor binding protein 1 (.1) Lus10027279 [exp] 51 / 2e-08 AT3G56710 46 / 2e-06 sigma factor binding protein 1 (.1) Lus10039494 [exp] 50 / 4e-08 AT3G56710 56 / 3e-10 sigma factor binding protein 1 (.1) Lus10024139 [exp] 50 / 4e-08 AT3G56710 58 / 5e-11 sigma factor binding protein 1 (.1) Lus10039493 [exp] 49 / 2e-07 AT3G56710 54 / 1e-09 sigma factor binding protein 1 (.1) Lus10008659 [exp] 46 / 8e-07 ND 44 / 4e-06 Lus10026165 [exp] 41 / 7e-05 AT3G56710 44 / 3e-06 sigma factor binding protein 1 (.1) Lus10022005 [exp] 41 / 8e-05 AT3G56710 48 / 1e-07 sigma factor binding protein 1 (.1) Lus10005523 [exp] 39 / 0.0005 ND 46 / 2e-06 Lus10006569 [exp] 39 / 0.0006 ND 44 / 1e-05
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05678 [poplar] [flax] VQ VQ motif
Representative CDS sequence Show only first row Show all	>Potri.016G036600.1 pacid=42809221 polypeptide=Potri.016G036600.1.p locus=Potri.016G036600 ID=Potri.016G036600.1.v4.1 annot-version=v4.1 ATGGACAATTATCATATTGACCTGGTAGGTGGTGGTGTGCAAGAAAGAAAGGGAACAAAAATAGCCAAAACCAAGAAAAAGCCTATGAAAGTAGTGTACA TATCCAACCCCATGAAGTTCAAGATTAGTGCATCTGGATTTAGGGCTTTGGTTCAAGAACTCACCGGCCAAGATTCTGAATTGCCAGACCCTACTAAGAT TGTGGACGATGATGATCATGGTGTCGGTGGAAATTATCGAACGGTTTCAAATGCTTCAAAAACTGTTGTTGATGATCACTGTGCACTAGAGGTCCCCACA AAGGATCCTAGTCAAGAGCAGCCGCCTGCAAGACAAGATGCTCCATTTGGGTCTTTCGATGACGTTTTCATGCCTCAGATGTTAGAGAATGTTGCTGGAA TAATGCCATCAAATTCATGGTACGAAGCTTACTCATATGGATATGGTGAGAAGCCTTGCAGTATAATTTGA
AA sequence Show only first row Show all	>Potri.016G036600.1 pacid=42809221 polypeptide=Potri.016G036600.1.p locus=Potri.016G036600 ID=Potri.016G036600.1.v4.1 annot-version=v4.1 MDNYHIDLVGGGVQERKGTKIAKTKKKPMKVVYISNPMKFKISASGFRALVQELTGQDSELPDPTKIVDDDDHGVGGNYRTVSNASKTVVDDHCALEVPT KDPSQEQPPARQDAPFGSFDDVFMPQMLENVAGIMPSNSWYEAYSYGYGEKPCSII

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G56710		SIB1	sigma factor binding protein 1...		Potri.016G036600 [exp]	0	1
AT1G75800			Pathogenesis-related thaumatin...		Potri.001G221900 [exp]	1.00	0.9504
AT5G60900		RLK1	receptor-like protein kinase 1...		Potri.003G211932 [exp]	2.00	0.9277
AT2G37710		RLK	receptor lectin kinase (.1)		Potri.006G088900 [exp]	6.24	0.8987
AT5G54630	C2H2ZnF		zinc finger protein-related (....		Potri.011G131300 [exp]	8.48	0.8871
AT5G24530		DMR6	DOWNY MILDEW RESISTANT 6, 2-ox...		Potri.012G006300 [exp]	15.29	0.8632
AT2G37710		RLK	receptor lectin kinase (.1)		Potri.006G088648 [exp]	15.36	0.8976
AT1G75800			Pathogenesis-related thaumatin...		Potri.001G221500 [exp]	16.97	0.8773
AT1G75800			Pathogenesis-related thaumatin...		Potri.001G284305 [exp]	17.49	0.8763
AT3G29780		RALFL27	ralf-like 27 (.1)		Potri.017G095700 [exp]	25.09	0.8901
AT1G55020		ATLOX1, LOX1	ARABIDOPSIS LIPOXYGENASE 1, li...		Potri.013G022100 [exp]	29.73	0.8815

Compare expression of checked genes

Potri.016G036600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.