Plant FIBer expression Database

Potri.016G041301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G044300
[exp]
120 / 2e-37 ND /
Potri.006G044200
[exp]
48 / 7e-09 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042011
[exp]
61 / 5e-14 ND /
Lus10018015
[exp]
61 / 1e-13 ND /
Lus10042010
[exp]
57 / 2e-12 ND /
Lus10031026
[exp]
49 / 2e-09 ND /
Lus10018014
[exp]
49 / 3e-09 ND /
PFAM info
Representative CDS sequence
>Potri.016G041301.1 pacid=42810557 polypeptide=Potri.016G041301.1.p locus=Potri.016G041301 ID=Potri.016G041301.1.v4.1 annot-version=v4.1
ATGGCTGGCCTTCAATACAAATTCTTCCCTACAGATTTCTTCTACCCTCCTCGTCCACAATCTGTGAAAGTAGACACCGGCACCACCGCCCAGAAAAGTA
TTGCTCTTCCCTTGGAGGTTCAAAAGCGAGAAGTCATGATCACTGATGATCTAAACCAGAAACACCACCCCACAAGCTTAGTTCTACGCCACAGCAAGCA
TGGCAACAAGTCCAGTACCCCCATGAACAGGAGGAGTACTGCATAA
AA sequence
>Potri.016G041301.1 pacid=42810557 polypeptide=Potri.016G041301.1.p locus=Potri.016G041301 ID=Potri.016G041301.1.v4.1 annot-version=v4.1
MAGLQYKFFPTDFFYPPRPQSVKVDTGTTAQKSIALPLEVQKREVMITDDLNQKHHPTSLVLRHSKHGNKSSTPMNRRSTA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.016G041301
[exp]
0 1
AT2G45680 TCP TCP9 TCP family transcription facto... Potri.002G152200
[exp]
1.41 0.9482
AT3G02468 CPuORF9 conserved peptide upstream ope... Potri.004G106750
[exp]
2.00 0.9248
AT3G09600 MYB LCL5 (LHY-CCA1-... REVEILLE 8, LHY-CCA1-LIKE5, Ho... Potri.016G083900
[exp]
3.46 0.9291
AT5G55340 MBOAT (membrane bound O-acyl t... Potri.008G145700
[exp]
4.89 0.8850
AT1G20440 AtCOR47, RD17, ... cold-regulated 47 (.1) Potri.002G013200
[exp]
5.83 0.9321
Potri.018G001950
[exp]
8.06 0.9188
AT1G24330 ARM repeat superfamily protein... Potri.008G177100
[exp]
8.24 0.8537
AT5G54470 CO B-box type zinc finger family ... Potri.001G414700
[exp]
10.95 0.8577
AT2G41060 RNA-binding (RRM/RBD/RNP motif... Potri.005G081600
[exp]
15.32 0.8433
AT3G22120 CWLP cell wall-plasma membrane link... Potri.006G008500
[exp]
15.49 0.8666

Potri.016G041301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.