Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	ERD15.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G41430 121 / 1e-35 LSR1, CID1, ERD15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) AT4G14270 78 / 8e-19 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G044600 [exp] 251 / 5e-87 AT2G41430 122 / 3e-36 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Potri.001G023100 [exp] 107 / 8e-30 AT4G14270 89 / 3e-23 unknown protein Potri.003G202500 [exp] 97 / 6e-26 AT2G41430 81 / 5e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Potri.008G074600 [exp] 72 / 2e-16 AT4G14270 66 / 2e-14 unknown protein Potri.010G182800 [exp] 71 / 7e-16 AT4G14270 65 / 6e-14 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031029 [exp] 160 / 2e-51 AT2G41430 115 / 3e-34 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10035419 [exp] 154 / 3e-49 AT2G41430 113 / 2e-33 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10018018 [exp] 141 / 1e-43 AT2G41430 102 / 8e-29 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10042014 [exp] 138 / 2e-42 AT2G41430 99 / 1e-27 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10016358 [exp] 96 / 2e-25 AT2G41430 83 / 1e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10019769 [exp] 95 / 3e-25 AT2G41430 91 / 1e-23 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10040964 [exp] 74 / 4e-17 AT2G41430 69 / 2e-15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10009847 [exp] 64 / 2e-13 AT2G41430 63 / 3e-13 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.016G041600.1 pacid=42809390 polypeptide=Potri.016G041600.1.p locus=Potri.016G041600 ID=Potri.016G041600.1.v4.1 annot-version=v4.1 ATGGTCCGTACAAGAAACAGATATTTTCTCGTTCTTCGTTCAAAGGACTGCAGAGGTTGTGGTTTGAAAAGGATGGCTCTGGTTTCAGGAGGAAGGTCAA CGTTGAACCCAGATGCGCCTCTTTTTGTTCCTGCTGCTTATCGGCAAGTGGAGGATTTCTCTCCTGAGTGGTGGCAATTGGTGACAACGACAACATGGTT CCGGGATTACTGGCTAAGTCAGCATCAAGATGAGAACGGTTTCTATGACAACGCTGAGGATGAGTTTGGGCTTGATGGGAATAATGTAGCTGATCTGTTG CCGGATACATTTGATCTTGATGCTGGCGATTATTTTTCTAGTTTGGATTCTCAATTTGCAGGTTTCGCAGAGGAAGGCTCTTCTCCTTTACTTTCCAATG GAATGCTTGCAAATGGGTTTGTGTTGGAAGCAGAGGCACCGAAGAAGGAAACAGGTCTGAAATCCAGTGCTTGA
AA sequence Show only first row Show all	>Potri.016G041600.1 pacid=42809390 polypeptide=Potri.016G041600.1.p locus=Potri.016G041600 ID=Potri.016G041600.1.v4.1 annot-version=v4.1 MVRTRNRYFLVLRSKDCRGCGLKRMALVSGGRSTLNPDAPLFVPAAYRQVEDFSPEWWQLVTTTTWFRDYWLSQHQDENGFYDNAEDEFGLDGNNVADLL PDTFDLDAGDYFSSLDSQFAGFAEEGSSPLLSNGMLANGFVLEAEAPKKETGLKSSA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G41430		LSR1, CID1, ERD...	CTC-Interacting Domain 1, dehy...		Potri.016G041600 [exp]	0	1	ERD15.2
AT1G63260		TET10	tetraspanin10 (.1.2.3)		Potri.001G107200 [exp]	2.00	0.8860
AT4G22560			unknown protein		Potri.001G121600 [exp]	6.70	0.8712
AT3G58670			Protein of unknown function (D...		Potri.004G058000 [exp]	7.07	0.8448
AT3G12020			P-loop containing nucleoside t...		Potri.006G194900 [exp]	10.24	0.8384
AT3G59360		UTR6, ATUTR6	UDP-galactose transporter 6 (....		Potri.010G180500 [exp]	13.03	0.8213
AT4G37235			Uncharacterised protein family...		Potri.007G033600 [exp]	14.00	0.8653
AT5G17230		PSY	PHYTOENE SYNTHASE (.1.2.3)		Potri.003G218000 [exp]	16.43	0.8249
AT2G33060		AtRLP27	receptor like protein 27 (.1)		Potri.010G009400 [exp]	16.49	0.8513
AT3G15150		HPY2, ATMMS21	HIGH PLOIDY2, A. THALIANA METH...		Potri.011G141200 [exp]	17.54	0.8428
AT5G25050			Major facilitator superfamily ...		Potri.018G017100 [exp]	18.89	0.8329

Compare expression of checked genes

Potri.016G041600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.