Potri.016G046000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G58000 120 / 9e-35 VQ motif-containing protein (.1)
AT2G42140 115 / 6e-33 VQ motif-containing protein (.1)
AT2G44340 96 / 4e-25 VQ motif-containing protein (.1)
AT3G60090 79 / 1e-18 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G192100 272 / 8e-95 AT2G42140 86 / 2e-21 VQ motif-containing protein (.1)
Potri.001G230800 96 / 1e-25 AT2G44340 79 / 6e-19 VQ motif-containing protein (.1)
Potri.009G024200 93 / 1e-24 AT3G58000 73 / 7e-17 VQ motif-containing protein (.1)
Potri.001G029700 44 / 5e-06 AT3G56710 54 / 5e-10 sigma factor binding protein 1 (.1)
Potri.003G194700 43 / 1e-05 AT3G56710 54 / 6e-10 sigma factor binding protein 1 (.1)
Potri.005G057800 43 / 3e-05 AT3G18690 124 / 2e-35 MAP kinase substrate 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004172 77 / 4e-17 AT2G42140 72 / 2e-15 VQ motif-containing protein (.1)
Lus10021054 75 / 2e-16 AT2G44340 76 / 7e-17 VQ motif-containing protein (.1)
Lus10024139 43 / 3e-05 AT3G56710 58 / 5e-11 sigma factor binding protein 1 (.1)
Lus10039494 42 / 5e-05 AT3G56710 56 / 3e-10 sigma factor binding protein 1 (.1)
Lus10039493 40 / 0.0002 AT3G56710 54 / 1e-09 sigma factor binding protein 1 (.1)
Lus10008659 39 / 0.0006 ND 44 / 4e-06
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.016G046000.2 pacid=42810103 polypeptide=Potri.016G046000.2.p locus=Potri.016G046000 ID=Potri.016G046000.2.v4.1 annot-version=v4.1
ATGGAGGAACTTATGATGAGGAAACAACCAGCAGCTTGTATCCCTACTTCAATTACTCCATCGCCAATCACCATGCATAAAAACTCACACACAATAGCCA
AAGTCAAGCCAAAGATACGCATAATTCACATCTTTGCTCCAGAAATCATCAAGACAGATGCCGCGAACTTCAGAGAGTTGGTACAAAGACTCACAGGGAA
ACCAAGTGATCAAAAGGGGGGTTGCAGGCAGAAACCAAGAAGGGCAAGAACACAAGATCAACCAAGAAACTGCAACAGCGACTTATGTGAAGAAAAGCCT
GTTATGACCAAGAAAGTTGAGCCGAGAAGTGGGTTTGGGAGTAGTCTGGGGTCTAGAGAAAGAGTTAAGGAGGAAGAAGAAATGTGGAATGGAGCATATT
CAGGAAGCTTCCTAGGTGGATTTACAGACTTGGATGGCTTCATTCAAGAACTTGGTGAATTTCCATTGCTGCCAATGGACGCTAATCACATACATGAGCT
TGGACAGACTCAACTTGCCTAG
AA sequence
>Potri.016G046000.2 pacid=42810103 polypeptide=Potri.016G046000.2.p locus=Potri.016G046000 ID=Potri.016G046000.2.v4.1 annot-version=v4.1
MEELMMRKQPAACIPTSITPSPITMHKNSHTIAKVKPKIRIIHIFAPEIIKTDAANFRELVQRLTGKPSDQKGGCRQKPRRARTQDQPRNCNSDLCEEKP
VMTKKVEPRSGFGSSLGSRERVKEEEEMWNGAYSGSFLGGFTDLDGFIQELGEFPLLPMDANHIHELGQTQLA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G58000 VQ motif-containing protein (.... Potri.016G046000 0 1
AT2G45360 Protein of unknown function (D... Potri.014G068900 4.79 0.9430
AT5G66420 unknown protein Potri.005G120100 7.34 0.9397
AT3G22800 Leucine-rich repeat (LRR) fami... Potri.010G083000 9.48 0.9373
Potri.019G016110 10.24 0.9384
AT1G68940 Armadillo/beta-catenin-like re... Potri.008G112900 12.00 0.8421
AT2G15490 UGT73B4 UDP-glycosyltransferase 73B4 (... Potri.016G057300 13.03 0.8618 Pt-ZOG1.8
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Potri.004G090600 14.00 0.9383
AT4G35220 Cyclase family protein (.1) Potri.001G301700 17.32 0.9262
AT2G45220 Plant invertase/pectin methyle... Potri.015G127700 18.33 0.9285 Pt-PME.5
Potri.018G118900 18.49 0.9272

Potri.016G046000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.