Potri.016G047700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G212150 42 / 2e-06 ND /
Potri.T084100 41 / 5e-06 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.016G047700.1 pacid=42810641 polypeptide=Potri.016G047700.1.p locus=Potri.016G047700 ID=Potri.016G047700.1.v4.1 annot-version=v4.1
ATGAAGATCAATAGCAGAACTCTGGCCGCTCTCTTCGTTTTGATTCTTGTTCACATTCTTGCATCATCCTCGCTATGTCTTTGCCATGAAGAGAGTAGTC
TAATCCCAAGCAAAAGAAGCACAATATCGAGGAAGCTACTAGCAACTCCATTGAAGTCAAGAGAGAACAAGTTGGGTGATGGAACAATGAAAGAGGCCAA
GAAAGCTGTGGAGCAAAGCCTAAGGAAAGCGCCACCAAGTGTCTCTAATCCTATACAAAACTAG
AA sequence
>Potri.016G047700.1 pacid=42810641 polypeptide=Potri.016G047700.1.p locus=Potri.016G047700 ID=Potri.016G047700.1.v4.1 annot-version=v4.1
MKINSRTLAALFVLILVHILASSSLCLCHEESSLIPSKRSTISRKLLATPLKSRENKLGDGTMKEAKKAVEQSLRKAPPSVSNPIQN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.016G047700 0 1
AT5G27060 AtRLP53 receptor like protein 53 (.1) Potri.001G389100 1.00 0.9705 PSCLRR52.53
Potri.001G472101 1.41 0.9651
AT4G35160 O-methyltransferase family pro... Potri.011G059600 1.73 0.9629 FOMT8,OOMT2.20
AT5G14420 RGLG2 RING domain ligase2 (.1.2.3.4) Potri.006G002600 2.44 0.9548
Potri.014G178900 3.87 0.9567
AT2G38870 Serine protease inhibitor, pot... Potri.006G212200 4.47 0.9578
AT5G15290 CASP5 Casparian strip membrane domai... Potri.012G032300 4.58 0.9542
Potri.001G290300 5.19 0.9394
AT4G35690 Arabidopsis protein of unknown... Potri.005G103600 5.65 0.9450
AT2G24130 Leucine-rich receptor-like pro... Potri.018G103400 7.54 0.9260

Potri.016G047700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.