Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06900 218 / 3e-69 CYP93D1 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) AT2G45580 187 / 3e-57 CYP76C3 "cytochrome P450, family 76, subfamily C, polypeptide 3", cytochrome P450, family 76, subfamily C, polypeptide 3 (.1) AT4G31940 179 / 4e-54 CYP82C4 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) AT2G45550 179 / 5e-54 CYP76C4 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) AT3G20120 176 / 6e-54 CYP705A21 "cytochrome P450, family 705, subfamily A, polypeptide 21", cytochrome P450, family 705, subfamily A, polypeptide 21 (.1.2) AT3G20100 178 / 9e-54 CYP705A19 "cytochrome P450, family 705, subfamily A, polypeptide 19", cytochrome P450, family 705, subfamily A, polypeptide 19 (.1) AT2G45570 177 / 2e-53 CYP76C2 "cytochrome P450, family 76, subfamily C, polypeptide 2", cytochrome P450, family 76, subfamily C, polypeptide 2 (.1) AT4G31970 176 / 9e-53 CYP82C2, JAH1 "cytochrome P450, family 82, subfamily C, polypeptide 2", cytochrome P450, family 82, subfamily C, polypeptide 2 (.1) AT3G20130 175 / 9e-53 GPS1, CYP705A22 gravity persistence signal 1, "cytochrome P450, family 705, subfamily A, polypeptide 22", cytochrome P450, family 705, subfamily A, polypeptide 22 (.1.2) AT3G20960 173 / 1e-52 CYP705A33 "cytochrome P450, family 705, subfamily A, polypeptide 33", cytochrome P450, family 705, subfamily A, polypeptide 33 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G058200 [exp] 370 / 2e-128 AT5G06900 584 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Potri.016G049800 [exp] 271 / 2e-89 AT5G06900 536 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Potri.013G027000 [exp] 234 / 4e-75 AT5G06900 357 / 3e-118 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Potri.005G037100 [exp] 228 / 6e-73 AT5G06900 383 / 4e-128 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Potri.005G037201 [exp] 228 / 6e-73 AT5G06900 382 / 6e-128 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Potri.016G052600 [exp] 204 / 1e-63 AT2G42250 512 / 2e-178 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1) Potri.004G147600 [exp] 183 / 3e-58 AT4G31940 351 / 3e-119 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.006G057900 [exp] 189 / 6e-58 AT2G42250 725 / 0.0 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1) Potri.006G190800 [exp] 187 / 7e-57 AT2G42250 509 / 2e-177 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035502 [exp] 259 / 9e-85 AT5G06900 533 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10027798 [exp] 246 / 4e-82 AT5G06900 349 / 1e-117 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10027796 [exp] 200 / 2e-65 AT5G06900 186 / 3e-56 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10005878 [exp] 200 / 6e-62 AT5G06900 440 / 1e-150 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10040868 [exp] 196 / 2e-60 AT5G06900 434 / 5e-148 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10025901 [exp] 182 / 4e-55 AT4G31940 426 / 2e-144 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10023827 [exp] 180 / 2e-54 AT2G42250 652 / 0.0 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1) Lus10025904 [exp] 180 / 4e-54 AT4G31940 413 / 3e-139 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10028881 [exp] 174 / 5e-52 AT2G45550 477 / 4e-165 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Lus10008938 [exp] 172 / 2e-51 AT2G45550 457 / 2e-157 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.016G049900.2 pacid=42809206 polypeptide=Potri.016G049900.2.p locus=Potri.016G049900 ID=Potri.016G049900.2.v4.1 annot-version=v4.1 ATGATGGAGAAAGCTAGACAGAAAATTGACTCTGTTGTGGGAAGGAGCAGGCTAGTACAAGAATCAGATATAGCAAATCCTCCATACCTGCAGGCTATAG TAAAAGAAACACTAAGGCTCCACCCTACTGGTCCATTGATAGTCAGAGAATCATTAGAAGACTGTACCATTGCTGGATACAAAATTCCAGCGAACACCAG ACTGTTTGTTAATATTTGGTCACTTGGAAGGGATCCAAATCACTGGGAAAACCCACTTGATTTTAGGCCACAGAGATTTACTGGTGAAGACTGGAGTGGA AATAGTAACATGATGGATGTGAGAGGGCAGCATTTTCATCTATTACCATTTGGGACTGGAAGAAGAAGCTGTCCTGGAGCTTCATTTGCACTACAGTTTG TTCCAACAACTCTTGCTGCTTTGATCCAGTGCTTTGAGTGGAAGGTGGGCGATGGGGAGTGTGGTACTGTTGACATGGATGAGGGACCTGGACTAACCCT TCCTAGGGCTCATTCCCTGGTTTGCATCCCAGTGTCCAGGCCCTGTCCATTTTTAGCAGCGTGA
AA sequence Show only first row Show all	>Potri.016G049900.2 pacid=42809206 polypeptide=Potri.016G049900.2.p locus=Potri.016G049900 ID=Potri.016G049900.2.v4.1 annot-version=v4.1 MMEKARQKIDSVVGRSRLVQESDIANPPYLQAIVKETLRLHPTGPLIVRESLEDCTIAGYKIPANTRLFVNIWSLGRDPNHWENPLDFRPQRFTGEDWSG NSNMMDVRGQHFHLLPFGTGRRSCPGASFALQFVPTTLAALIQCFEWKVGDGECGTVDMDEGPGLTLPRAHSLVCIPVSRPCPFLAA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G06900		CYP93D1	"cytochrome P450, family 93, s...		Potri.016G049900 [exp]	0	1
AT1G19010			unknown protein		Potri.017G074300 [exp]	2.44	0.9273
AT1G20950			Phosphofructokinase family pro...		Potri.010G106950 [exp]	3.87	0.9349
AT3G47570			Leucine-rich repeat protein ki...		Potri.010G228300 [exp]	4.58	0.9225
AT5G56190			Transducin/WD40 repeat-like su...		Potri.016G000800 [exp]	5.09	0.9023
AT2G32950		FUS1, EMB168, D...	FUSCA 1, EMBRYO DEFECTIVE 168,...		Potri.004G002700 [exp]	5.47	0.8827
AT4G27190			NB-ARC domain-containing disea...		Potri.001G446966 [exp]	8.66	0.8496
					Potri.006G225133 [exp]	8.66	0.9015
AT5G43990		SDG18, SUVR2	SET DOMAIN PROTEIN 18, SET-dom...		Potri.002G257400 [exp]	12.96	0.8740
AT2G43490			Ypt/Rab-GAP domain of gyp1p su...		Potri.017G023200 [exp]	13.60	0.8770
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Potri.005G143800 [exp]	15.49	0.8300	CYP81S7,CYP81.2

Compare expression of checked genes

Potri.016G049900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.