Potri.016G050900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57810 301 / 5e-101 Cysteine proteinases superfamily protein (.1.2.3)
AT2G38025 74 / 6e-15 Cysteine proteinases superfamily protein (.1)
AT2G27350 53 / 2e-07 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
AT3G62940 47 / 1e-05 Cysteine proteinases superfamily protein (.1.2.3)
AT1G50670 42 / 0.0003 OTU-like cysteine protease family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G057400 526 / 0 AT3G57810 308 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Potri.008G177400 238 / 1e-78 AT3G57810 223 / 6e-74 Cysteine proteinases superfamily protein (.1.2.3)
Potri.010G234300 206 / 8e-64 AT3G57810 195 / 9e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.008G026100 206 / 1e-63 AT3G57810 197 / 2e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.016G110400 89 / 2e-20 AT2G38025 276 / 1e-94 Cysteine proteinases superfamily protein (.1)
Potri.010G057750 61 / 8e-12 AT3G57810 52 / 1e-09 Cysteine proteinases superfamily protein (.1.2.3)
Potri.004G196800 54 / 7e-08 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.009G160100 54 / 1e-07 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020438 399 / 1e-139 AT3G57810 290 / 3e-97 Cysteine proteinases superfamily protein (.1.2.3)
Lus10037002 226 / 1e-73 AT3G57810 213 / 2e-70 Cysteine proteinases superfamily protein (.1.2.3)
Lus10015803 225 / 2e-73 AT3G57810 215 / 3e-71 Cysteine proteinases superfamily protein (.1.2.3)
Lus10008986 194 / 3e-59 AT3G57810 187 / 9e-58 Cysteine proteinases superfamily protein (.1.2.3)
Lus10028840 194 / 3e-58 AT3G57810 194 / 4e-59 Cysteine proteinases superfamily protein (.1.2.3)
Lus10027758 66 / 6e-12 AT2G38025 227 / 4e-75 Cysteine proteinases superfamily protein (.1)
Lus10005193 54 / 7e-08 AT2G27350 549 / 0.0 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Lus10013303 44 / 0.0001 AT2G27350 468 / 7e-162 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Potri.016G050900.2 pacid=42810142 polypeptide=Potri.016G050900.2.p locus=Potri.016G050900 ID=Potri.016G050900.2.v4.1 annot-version=v4.1
ATGCCTGTTATTAGTTGGCCACTTAATTGTTGTCCTTTGTGCGCGTGTCCAGGCTATGCCAGCATGATTGTTTGCTCTCCCATTAGTACATGTGTGAAGA
ATGTTGTCCACCTGAGTAGCCGTGTTCAACAAATGGGCAGCACTATCTTGAATGTGGTATCTGGAGGACAAACCACTTCTTGCTGTTTTTCTTCGTACCC
TGGTCTTTCCAGGTCAAGTTATTCTCGTTTGTCTGTCTCAAAGACATTCTCTTGTCCATCAATTAGCTATCAAACGATACAGAGCAACTGTTTTGGATCT
GTTTTGACCAAGCAAAGGGCTGATTTGCAATCATTTTCTGTAAAAGGTGTAGTTAGATCTAGAGGTCCTCTGAAGAGACAATTCAATATTTCATTGCCAT
GCCAAATCATGAATCTGAGGTTTTCAGTTTCAAAACAAGGAGTTCTATCCAAAATCAATGATAATACAGGATCTATTTCTTGGTCACAAGGATATCCCAC
CACTGGCATAATTTTTGGACTTCTGGTTTGTTATTCAAGTTCTGAGCCAACACACGCTGAAGCAGCTACACACAAGAATGAAGAGGAGGACAATTGCAAT
TTATCAGATATTAAATTCTCACACGGGAAGGAAGTTTACAGAGACTACTCCATTATTGGAATACCAGGAGATGGTAGATGTTTGTTCCGCTCTGTGGCTC
ACGGGGCTTGTATACGGTCTGGGAAACCAGCTCCAAGTGAAAACCTTCAGAGAGAATTAGCAGATGACTTGCGTTCTAAAGTTGCTGACGAGTTTATCAA
GAGAAGGGAGGAGACAGAATGGTTTATAGAAGGCAATTTTGACACCTATGTGTCAAGAATCAGGAAGCCACATGTGTGGGGCGGTGAGCCTGAGTTGTTG
ATGGCTTCTCATGTTCTCAAGATGCCAATCACTGTGTACATGGATGACAAAAATTCTGGGGGCTTGATATCCATTGCAGAGTATGGTCAGGAGTACGGGA
AGGAAGATCCAATTAGGATTATATATCATGGTTTTGGCCATTATGATGCCTTACAGTTTCCAAGAACCAGAGGTGGTAAATCAAAACTTTAA
AA sequence
>Potri.016G050900.2 pacid=42810142 polypeptide=Potri.016G050900.2.p locus=Potri.016G050900 ID=Potri.016G050900.2.v4.1 annot-version=v4.1
MPVISWPLNCCPLCACPGYASMIVCSPISTCVKNVVHLSSRVQQMGSTILNVVSGGQTTSCCFSSYPGLSRSSYSRLSVSKTFSCPSISYQTIQSNCFGS
VLTKQRADLQSFSVKGVVRSRGPLKRQFNISLPCQIMNLRFSVSKQGVLSKINDNTGSISWSQGYPTTGIIFGLLVCYSSSEPTHAEAATHKNEEEDNCN
LSDIKFSHGKEVYRDYSIIGIPGDGRCLFRSVAHGACIRSGKPAPSENLQRELADDLRSKVADEFIKRREETEWFIEGNFDTYVSRIRKPHVWGGEPELL
MASHVLKMPITVYMDDKNSGGLISIAEYGQEYGKEDPIRIIYHGFGHYDALQFPRTRGGKSKL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G57810 Cysteine proteinases superfami... Potri.016G050900 0 1
AT5G48570 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-... Potri.006G033400 1.41 0.7695
AT5G17400 ER-ANT1 endoplasmic reticulum-adenine ... Potri.012G062500 10.48 0.6855
AT5G57000 unknown protein Potri.006G148000 12.96 0.6616
AT3G47590 alpha/beta-Hydrolases superfam... Potri.018G068000 15.29 0.7263
AT3G19950 RING/U-box superfamily protein... Potri.007G074014 18.02 0.6600
AT5G58220 ALNS, TTL allantoin synthase, transthyre... Potri.002G238300 23.57 0.7260
AT1G23780 F-box family protein (.1) Potri.005G109700 26.72 0.6364
AT2G42070 ATNUDX23, ATNUD... ARABIDOPSIS THALIANA NUDIX HYD... Potri.006G192800 27.12 0.6244
AT3G29270 RING/U-box superfamily protein... Potri.012G067200 34.11 0.6370
AT4G16745 Exostosin family protein (.1.2... Potri.003G079000 41.46 0.6863

Potri.016G050900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.