Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G42310 169 / 4e-56 unknown protein AT3G57785 169 / 1e-55 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G056900 [exp] 203 / 2e-69 AT3G57785 156 / 6e-51 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026317 [exp] 183 / 7e-60 AT2G42310 173 / 1e-55 unknown protein Lus10042351 [exp] 178 / 3e-59 AT2G42310 169 / 6e-56 unknown protein Lus10011305 [exp] 163 / 2e-53 AT2G42310 164 / 1e-53 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10183 [poplar] [flax] ESSS ESSS subunit of NADH:ubiquinone oxidoreductase (complex I)
Representative CDS sequence Show only first row Show all	>Potri.016G051400.1 pacid=42809730 polypeptide=Potri.016G051400.1.p locus=Potri.016G051400 ID=Potri.016G051400.1.v4.1 annot-version=v4.1 ATGCCCTTCACAACGGCATCCTCCATGCTCCGCCACCGCATCTCCAGCGCCCTCCGAACCCGCGGCGGCGCAAAAGCTGGTCCCAGCAGATGGAAATCTC CGGGACACGAGGAACAACCCAAAGGTCACTTTCTCAATCGGACCCCACCACCACCCGGAGAGTCTCGTAAATGGGAAGATTGGGAGTTGCCTTGCTACAT CACCAGCTTCTTAACGATTGTGATCCTTGGCGTTGGTCTCAATGCTAAGCCTGATCTCACTATTGAAACTTGGGCTCATCAGAAAGCACTTGAACGACTC CAGATGGAGAAGTTGGGCCTCTCCGGTTCTGCTGATTCTGAGTGA
AA sequence Show only first row Show all	>Potri.016G051400.1 pacid=42809730 polypeptide=Potri.016G051400.1.p locus=Potri.016G051400 ID=Potri.016G051400.1.v4.1 annot-version=v4.1 MPFTTASSMLRHRISSALRTRGGAKAGPSRWKSPGHEEQPKGHFLNRTPPPPGESRKWEDWELPCYITSFLTIVILGVGLNAKPDLTIETWAHQKALERL QMEKLGLSGSADSE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G42310			unknown protein		Potri.016G051400 [exp]	0	1
AT1G09630		ATRAB-A2A, ATRA...	ARABIDOPSIS RAB GTPASE A2A, RA...		Potri.004G226400 [exp]	1.00	0.9261
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Potri.017G086900 [exp]	7.07	0.9048
AT1G16560			Per1-like family protein (.1.2...		Potri.007G065800 [exp]	7.34	0.9042
AT1G51160			SNARE-like superfamily protein...		Potri.017G149900 [exp]	9.48	0.9204
AT3G07480			2Fe-2S ferredoxin-like superfa...		Potri.014G177100 [exp]	10.09	0.9193
AT5G19980		GONST4	golgi nucleotide sugar transpo...		Potri.018G071700 [exp]	10.39	0.9112
AT4G11150		TUFF, EMB2448, ...	embryo defective 2448, vacuola...		Potri.019G029200 [exp]	10.39	0.9254	VATE.1
AT5G17190			unknown protein		Potri.010G108000 [exp]	11.83	0.9077
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Potri.001G222200 [exp]	13.41	0.9187	Pt-ACCAL.3
AT5G60460			Preprotein translocase Sec, Se...		Potri.009G012000 [exp]	13.85	0.8663

Compare expression of checked genes

Potri.016G051400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.