Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52105 75 / 2e-19 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G054200 [exp] 107 / 2e-32 AT3G52105 67 / 2e-16 unknown protein Potri.001G267501 [exp] 91 / 8e-26 AT3G52105 87 / 9e-25 unknown protein Potri.009G061800 [exp] 89 / 7e-25 AT3G52105 90 / 1e-25 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012208 [exp] 96 / 7e-28 AT3G52105 70 / 5e-18 unknown protein Lus10011321 [exp] 96 / 1e-27 AT3G52105 72 / 1e-18 unknown protein Lus10042363 [exp] 96 / 1e-27 AT3G52105 75 / 6e-20 unknown protein Lus10029521 [exp] 90 / 2e-25 AT3G52105 85 / 8e-24 unknown protein Lus10026305 [exp] 96 / 2e-24 AT3G57570 229 / 2e-65 ARM repeat superfamily protein (.1.2) Lus10016415 [exp] 86 / 1e-23 AT3G52105 81 / 3e-22 unknown protein Lus10019704 [exp] 85 / 2e-23 AT3G52105 80 / 6e-22 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.016G053400.1 pacid=42809654 polypeptide=Potri.016G053400.1.p locus=Potri.016G053400 ID=Potri.016G053400.1.v4.1 annot-version=v4.1 ATGCTGCAGTTGTTCTTCGCGGTGGCCTTCTCGGCGGTGCCTTTGACCCTCTACGTTCCGCCCATTCGATCTCTAAACTTATTCGTGGAGACCATGGAGG ATGTATTACGCCAGACATCCTTGTACACCGTCAGGGCTTATCCTAGGATTCGTCTTGTGTTTTCTCGTTTCTTTCGCAATCTCTTTAACTTGTCCAGTGT TACAAACGGTATCTTAATTCGGTCCAAGAGGACAGGTGGGGCTGAAAGGGAAATTGGAGCATTCATGTGCTAG
AA sequence Show only first row Show all	>Potri.016G053400.1 pacid=42809654 polypeptide=Potri.016G053400.1.p locus=Potri.016G053400 ID=Potri.016G053400.1.v4.1 annot-version=v4.1 MLQLFFAVAFSAVPLTLYVPPIRSLNLFVETMEDVLRQTSLYTVRAYPRIRLVFSRFFRNLFNLSSVTNGILIRSKRTGGAEREIGAFMC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G52105			unknown protein		Potri.016G053400 [exp]	0	1
AT5G12840	CCAAT	NF-YA1, ATHAP2A...	"nuclear factor Y, subunit A1"...		Potri.009G060600 [exp]	4.69	0.6901
AT3G52420		ATOEP7	outer envelope membrane protei...		Potri.002G054700 [exp]	6.48	0.6678
AT2G28840		XBAT31	XB3 ortholog 1 in Arabidopsis ...		Potri.009G030000 [exp]	6.92	0.6636
AT1G67850			Protein of unknown function (D...		Potri.010G047200 [exp]	35.00	0.6032
AT2G01430	HD	ATHB17, ATHB-17	ARABIDOPSIS THALIANA HOMEOBOX-...		Potri.010G112600 [exp]	37.64	0.6183
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Potri.002G224800 [exp]	39.62	0.6266	Pt-SMT3.1
AT3G15355		UBC25 ,PFU1	PHO2 FAMILY UBIQUITIN CONJUGAT...		Potri.013G130800 [exp]	42.82	0.6168
AT3G07570			Cytochrome b561/ferric reducta...		Potri.014G197500 [exp]	43.45	0.6128
AT4G15093			catalytic LigB subunit of arom...		Potri.004G135200 [exp]	56.50	0.5886
AT3G08760		ATSIK	Protein kinase superfamily pro...		Potri.016G136400 [exp]	58.88	0.5867

Compare expression of checked genes

Potri.016G053400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.